[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA58208.1


[Show Plain Result]

## Summary of Sequence Search
   1::728
 234::634  8.4e-49 32.7% 0052828 00528281 1/1   RpiA/CoA transferase-like               
 233::633  2.3e-42 32.5% 0051075 00510751 1/1   RpiA/CoA transferase-like               
 235::591  2.9e-08 25.1% 0042405 00424051 1/1   RpiA/CoA transferase-like               
 490::588  1.3e-05 29.7% 0040764 00407642 2/2   RpiA/CoA transferase-like               
 240::276   0.0021 33.3% 0040764 00407641 1/2   RpiA/CoA transferase-like               
 237::279    0.064 26.2% 0051773 00517731 1/2   RpiA/CoA transferase-like               
 429::596    0.081 29.9% 0051773 00517732 2/2   RpiA/CoA transferase-like               
   1::728


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVRNSNRPTYYADVESCVENILSKVGKNIVLGIPIGLGKPNQLVNEFFRRATKDPTLRLKIFTALTLTKP
00528281   1/1  ----------------------------------------------------------------------
00510751   1/1  ----------------------------------------------------------------------
00424051   1/1  ----------------------------------------------------------------------
00407642   2/2  ----------------------------------------------------------------------
00407641   1/2  ----------------------------------------------------------------------
00517731   1/2  ----------------------------------------------------------------------
00517732   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QWKNGLERRLVEPLSARIFGNYPELDYISALERSQLPPNIEVAEFYFQPGQLLHNSHAQQNYVSSNYTHV
00528281   1/1  ----------------------------------------------------------------------
00510751   1/1  ----------------------------------------------------------------------
00424051   1/1  ----------------------------------------------------------------------
00407642   2/2  ----------------------------------------------------------------------
00407641   1/2  ----------------------------------------------------------------------
00517731   1/2  ----------------------------------------------------------------------
00517732   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VRDSLDSDMNVFAQLISSAKQWENKTYYSLSCNADLTPDLIPKMRGLEKSGKKIAILGQINPELPFMYGD
00528281   1/1  ----------------------------------------------------------------------
00510751   1/1  ----------------------------------------------------------------------
00424051   1/1  ----------------------------------------------------------------------
00407642   2/2  ----------------------------------------------------------------------
00407641   1/2  ----------------------------------------------------------------------
00517731   1/2  ----------------------------------------------------------------------
00517732   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AQVPSENFDAIVDHPQYAFKLFGPPNMAINPSDYMIGLHASALIKDGGTIQLGIGSLSDAVTYLIKMRHQ
00528281   1/1  -----------------------lpflppdpveraiarrlaeklmsaveaarlikdgatlqlGiGgipna
00510751   1/1  ----------------------glprlpldevelliarraaellvaegllkdgltlqlGiGgipnavana
00424051   1/1  ------------------------dlleltireliavraarel.kdgevvnlGiG.iPnlvanllretga
00407642   2/2  ----------------------------------------------------------------------
00407641   1/2  -----------------------------ddvreliarraarelkdglvvnlGiG.iPtavanlla----
00517731   1/2  --------------------------meltlrel.iarraareledgevvnlGiGiPtlvaavlaeeth-
00517732   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YNAVYCALLSEANVLGKFEKMIHNVGGNEPFKEGLYATSEMFVDGFMQLYRSGILKRKVYPHETLQRLLN
00528281   1/1  VlaaLa................................erffidltlgaevgtdgmvdlieagvidr...
00510751   1/1  Laeg...............................glkpdltlhselngllgglvdlieegvvd......
00424051   1/1  pd...ltlisengvlglipaglplsgsdlallinagklrptaifdspelfdlirgGrl............
00407642   2/2  ----------------------------------------------------------------------
00407641   1/2  ----------------------------------------------------------------------
00517731   1/2  ----------------------------------------------------------------------
00517732   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ENKLSHQISPAALTRLIEEKIIHPQLSEKEVTLLQQWGIFKMELKYQNGFIYPPNEIPIPADLADSQSAE
00528281   1/1  ......................................................................
00510751   1/1  ......................................................................
00424051   1/1  ......................................................................
00407642   2/2  ----------------------------------------------------------------------
00407641   1/2  ----------------------------------------------------------------------
00517731   1/2  ----------------------------------------------------------------------
00517732   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           KIYRHCLEPHIKGGHLLHASFFLGPQRFYNFLRGLKKEEREQFCMKRVAYVNQLYGSEELKRLQRKDARF
00528281   1/1  ....................rl.ggqvg.llalginalygfldffds....hlslrpvlyvngpyiir..
00510751   1/1  .......................kivdsinfgkealyelldnnp......aaifdsalrfnlirggeiar
00424051   1/1  ......................................................................
00407642   2/2  ---------------------------------------------------------------------a
00407641   1/2  ----------------------------------------------------------------------
00517731   1/2  ----------------------------------------------------------------------
00517732   2/2  --------gvinagkalnaaaifdsadlFdlirgghld..............................va


                         *         -         -         -         -         +         -:560
query           LNSALMVTLNGAIISDKLEDGRTVSGVGGQYNFVAMAHALVDARSIIMLRSVREKHGEIHSNIIWNYGHT
00528281   1/1  ....glldvailgalevdlyGnvnsttigggkmvsGvGgamdfargA.....kkviialnsta.kggr.i
00510751   1/1  ..rldvaflg.alevdlyGnvNvstvi.pgrivsGvGGamdfaaga.....kkviialpst..kgg..is
00424051   1/1  dvaflgaaqvDlyGnvNvtvigdyliPgvrlpGsGGamdlaanak.....kvifmehsvrk....fvpkv
00407642   2/2  ilgalqvDlyGnvnstvi.ggkrlpGvGGamdlaaga.....krvivampshak..rggvskivpivslg
00407641   1/2  ----------------------------------------------------------------------
00517731   1/2  ----------------------------------------------------------------------
00517732   2/2  vlGalqvDlyGnlnvskiGg.rlp.GvGGamdlvaga.....kkvivvmtht.kkglrk...lveevdlp


                         -         -         -         *         -         -         -:630
query           TIPCHLRDMVVTEYGIANLRGKNDREIIIALLNITDSRFQDFLLREAQKAGKISKNYQIPDDFKDNYPAR
00528281   1/1  skivpkvshvttpeglvdivvTEyGvadlrglslrerapglilniahPdfredlleyaeaaligapdipv
00510751   1/1  kivpkvdhvttpggdvdvvvTelgvavdlrgkglrlr......eahpgvrlelvleatgfallvagdltp
00424051   1/1  dfvtsvghlegdvkrctlpltggggvdvvvT---------------------------------------
00407642   2/2  ltgrgdvdlvvTelgvfdldgerglvLi------------------------------------------
00407641   1/2  ----------------------------------------------------------------------
00517731   1/2  ----------------------------------------------------------------------
00517732   2/2  vtgvgvvdkvvtevgiatlsgklalerggpvlviTd----------------------------------


                         -         +         -         -         -         -         *:700
query           LKKHLRPYKDQGYLPEFPFGTEFTPEEIALTKAFEAIQTMIAKKRFPIPNKHQLRAILSAPEIATPYLQR
00528281   1/1  lpek------------------------------------------------------------------
00510751   1/1  mpl-------------------------------------------------------------------
00424051   1/1  ----------------------------------------------------------------------
00407642   2/2  ----------------------------------------------------------------------
00407641   1/2  ----------------------------------------------------------------------
00517731   1/2  ----------------------------------------------------------------------
00517732   2/2  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           LQLDKPTTMKDKLMQKLVLYGLSQTGAM------------------------------------------
00528281   1/1  ----------------------------------------------------------------------
00510751   1/1  ----------------------------------------------------------------------
00424051   1/1  ----------------------------------------------------------------------
00407642   2/2  ----------------------------------------------------------------------
00407641   1/2  ----------------------------------------------------------------------
00517731   1/2  ----------------------------------------------------------------------
00517732   2/2  ----------------------------------------------------------------------