[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA58418.1


[Show Plain Result]

## Summary of Sequence Search
   1::538
  10::529 2.3e-155 39.5% 0042298 00422981 1/1   l-CoA synthetase-like                   
   9::525 5.9e-149 38.5% 0043409 00434091 1/1   l-CoA synthetase-like                   
  11::533 8.5e-136 39.5% 0040451 00404511 1/1   l-CoA synthetase-like                   
   1::535 2.8e-133 39.1% 0044590 00445901 1/1   l-CoA synthetase-like                   
  10::535 6.4e-132 38.9% 0040895 00408951 1/1   l-CoA synthetase-like                   
   8::529 2.1e-130 39.3% 0043886 00438861 1/1   l-CoA synthetase-like                   
  11::529   7e-130 40.6% 0035109 00351091 1/1   l-CoA synthetase-like                   
   1::538


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSRIHSANSLVHSLVLDNALKGPDASALVHGDQTLTYASLGETVEACARGLLALGLASSERVAIYLPKRP
00422981   1/1  ---------lladpdlllsdldllslaeyelllewnvtdpelfwdelaelldwlklldlvlvldlllllp
00434091   1/1  --------adylalpelslsdlellweeeaelllvllnltavlllldlldlelllplakwflggllntlh
00404511   1/1  ----------erllllllllltelllpgpltlhdllerqaartpdrvalifegegrrlTYaellervnrl
00445901   1/1  pntelllpgpltlhdlleraaartpdrvalvfedegelrrlTyaellervnrlaaaLlalgvkpgdrVal
00408951   1/1  ---------llllsaellalllplnrtflplplltlhdllerqaartpdavalifegrrlTYaellervn
00438861   1/1  -------dltlldlleraaartpdrvaliflgegrrlTyaellervnrlaaaLlalgvkpgdrVaillpn
00351091   1/1  ----------llseldlllllllltlllllllltlhdlleraaartpdavalvfegrtlTYaeldervnr


                         -         -         *         -         -         -         -:140
query           ETVVTLFGAAAAGGVFVPINPLLKPRQVAHILRDCNVRVLVTASNRIDFLQDALAECHDLRSLVIVDAPT
00422981   1/1  llrwflggrlntlhdllerqaartpdrpalifeddgdgelrtlTYaeldervnrlAaaLralGvkpgdrV
00434091   1/1  dllerqaartpdrpalifedgldgelrrlTYaeldervnrlAaaLrsalGvkpgdrVaillpnspefvva
00404511   1/1  aaaLlalgvkpgdrValllpnspelvvallAvlkaGavyvplnptlpaerlayiledsgakllltdddll
00445901   1/1  llpnspelvvallAvlkaGavyvplnpalpaerlayiledsgakllltdddllelllellaelpslklvi
00408951   1/1  rlaaaLlalGvkpgdrVaillpnspelvvallAvlkaGavyvplnpalpaeelayiledsgakllltdde
00438861   1/1  spelvvallAvlkaGavyvplnpalpaerlayiledsgakllltddellelllel..alpslklvivld.
00351091   1/1  laaaLlalgvkpgdrValllpnspelvvallAvlkaGavyvplnpalpaerlayiledsgakllltdddl


                         +         -         -         -         -         *         -:210
query           QTIEKLAQPMAISWERLLSLGTTQQSPGHRRIDSDMAAILYTSGSTGRPKGVVLSHRNLVAGAQSVAQYL
00422981   1/1  aillpnspelvvallAvlkaGavyvplnptlpaerlayiledsgakllltddellellkeldlkelvdea
00434091   1/1  llAvlkaGavyvplnpglpaerlayiledsgakllltddellrggklidllelllealallpllklvvvl
00404511   1/1  dlllellaelpslklvivlddlllalllldglgvlslddllalgasaplplvpvdpddlayilyTSGTTG
00445901   1/1  vld.......dlallgllsledllaagp....plvpvdpddlayilyTSGTTGlPKgvvlthrnllanal
00408951   1/1  llellklllllelldelpslklvivldd.........llgvlsledlla....aplplvpvdpddlayil
00438861   1/1  ............llslddllaagsaalpavpvdpd.dlayilyTSGTTGkPKgvvlthrnllanalalar
00351091   1/1  lelllelladlpvl.....................lsleellaagsaal.plvpvdpddlayilyTSGTT


                         -         -         -         +         -         -         -:280
query           ENNSNDRLLAVLPLSFDAGFSQLTTAFSVGASVVLMEYLLPKDVIKSITRHGITGITAVPPLWVQLASLA
00422981   1/1  lelaelpslktvivlddlgll.adlallgvlslddllaag.saelpavpvdpddlayilyTSGTTGkPKg
00434091   1/1  ddlllllllllllgllsleellaaasa.alppvpvdpddlayilyTSGTTGkPKgVvlthrnlllalala
00404511   1/1  kPKgvvlthrnllanalalaeallllgltpgdrvlsflplfhdagllellgallaGatlvllsgfdperl
00445901   1/1  alllalalgltpgdvvlsflplfhdagllellgallaGatlvllsgrfdperlleliekykvtvlflvPt
00408951   1/1  yTSGTTGkPKgvvlthrnllanalalalalgltpgdrvlsflplfhvfglsvlellgallaGatlvllsg
00438861   1/1  alllgltpgdrvlsflplfhdaglllellgalllGatlvllsgfdperllelieeykvtvlflvPtllrl
00351091   1/1  GlPKgvvlthrnllalalalalalgltpgdrvlsflplahdagllellaallaGatlvllsgpllfdper


                         -         *         -         -         -         -         +:350
query           WPPEAADTLRYIANTGGRMPKAATTALRRSLPQTKVFLMYGLTEAFRSTYLPPEEVDKRPDSIGKAIPNV
00422981   1/1  vvlthrnllanaaallalalgltpgdrvlsflplahdaglllellgallaGatlvllsgapllfdperll
00434091   1/1  lalalgltpgdvvlsflplfhdaglvlellgpllaGatlvllpglplrfdperlleliekyrvtvlflvP
00404511   1/1  lelieeykvtvlflvPtllrlllkapelagldlsslrlllsgGeplppellerlrelfpgvrllngYGlT
00445901   1/1  llrlllkapelagldlsslrlllsgGeplppellerlre..lgvrllngYGlTEttvvvtlllpglllll
00408951   1/1  fdperllelieeykvtvlflvPtllrlllkapelagldlsslrlllsgGeplppellerlrelfg.vrll
00438861   1/1  llkapeellaaldlsslrlllsgGeplppellerlrelfg.vrllngYGlTEttgvvtlllp....kpgs
00351091   1/1  llelieeykvtvlflvPtllrlll.....kadlsslrlllsgGeplppellerlre...gvrllngYGlT


                         -         -         -         -         *         -         -:420
query           EIQVAREDGSLCLPGESGELVHRGVLVAMGYWNDPKKTAERFRPTPGQPPELPLTEIAVWSGDTVRMDED
00422981   1/1  elieeykvtvlflvPtllrlllkapeellapldlsslrlllsgGeplppellerlrelfpdlgvpllngY
00434091   1/1  tllrlllkapeellakldlsslrlllsgGeplppellerfrelfglsgvrllngYGlTEttvvvtlnppg
00404511   1/1  Ettvvvtllppg.dvkpgsigrplpgvevrivdpedgepvppgevGelvvrgpgvargYlndpeltaeaf
00445901   1/1  llldllalkpgsiGrplpgvevrivdpdgrpvppggeevGelvvrgpgvargYlndpeltaeafvedgw.
00408951   1/1  ngYGlTEttvvvtlllpgldvkpgsiGrplpgvlevrivdpdgepvppgevGelvirgpgvargYlndpe
00438861   1/1  igrplpgvevrivdpdeetgepvppgevGelvvrgppgvargYlndpeltaeafv............dgw
00351091   1/1  EttvvvtlllpgdllpvkpgsigrplpgvevrivdedgrpvppgevGellvrgpgvargYlndpeltaea


                         -         -         +         -         -         -         -:490
query           GFFYFIGRQDEMIKTSGYRVSPTEVEEVLYQAGLVAEAAVVGVLHPKLGQGIVAIVKPNKDNFDPEDLLA
00422981   1/1  GlTEttgvvtlnppgalpvkpgsiGrplpgvevrivdpdgrpvppgevGeLvvrgplpgvarGYlndpel
00434091   1/1  lalpvkpgsiGrplpgvevrivdedtgepvpplgevGeLvirgplpgvarGYlndpeltaeafvadp...
00404511   1/1  vedgw...........yrTGDlgrldedGylyilGRlddqikigGeriepgeiEavllshpavaeaaVvg
00445901   1/1  ..........yrTGDlgrldedGylyilGRlddqikigGeriepgeiEavllshpavaeaavvgvpdedg
00408951   1/1  ltaeafvedgw...........yrTGDlgrldedGylyilGRlddqikigGeriepgeiEavllshpava
00438861   1/1  yrTGDlgrldedgylyilGRlddqikigGeriepgeiEavllshpavaeaavvgvpdedggerlvafvvl
00351091   1/1  fvedpfs.....pgdgwyrTGDlgrldedGylyilGRlddqikigGeriepgeiEavllshpavaeaaVv


                         *         -         -         -         -         +         -:560
query           TCRAELPNFMVPLAVIVSENLPRNTNGKIDRRALAMEFELLFKEQTAP----------------------
00422981   1/1  taeafvadpdg.........wyrTGDlgrldedGyleil-------------------------------
00434091   1/1  ......dgwyrTGDlgrldedGyleilGRkddqik-----------------------------------
00404511   1/1  vpdedggerlvafvvlkpgaeldeeelraflrerlppeykvPr---------------------------
00445901   1/1  gerlvafvvlkpgaeldaeelraflrerlppykvPrrivfvdelp-------------------------
00408951   1/1  eaavvgvpdedggerlvafvvlkpgellaeelraflrerllppyk-------------------------
00438861   1/1  kpgaeldaeelraflrelrlppykvPrrivfvdelplta-------------------------------
00351091   1/1  gvpdelggerlvafvvlkpg.llaeelraflrerlppyk-------------------------------