[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA58420.1


[Show Plain Result]

## Summary of Sequence Search
   1::419
   4::411  2.9e-18 21.0% 0053131 00531311 1/1   lycosyltransferase/glycogen phosphoryla 
   5::312  1.5e-12 17.4% 0051981 00519811 1/1   lycosyltransferase/glycogen phosphoryla 
   1::412  1.7e-12 19.9% 0043452 00434521 1/1   lycosyltransferase/glycogen phosphoryla 
 106::378  2.8e-05 17.5% 0046716 00467161 1/1   lycosyltransferase/glycogen phosphoryla 
   1::419


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVKRVLMIAYHFPPASGSSGMQRTLSFSRDLPEHDWQPIILSIYPRAYERRCDDQLADIGSETIVYRAFG
00531311   1/1  ---kIllvtpslpp..vgGvervvlelaralakrghevtvltpgggglle....................
00519811   1/1  ----mkiililevapppkvGGaervvlelaraLakrGhevtvitpgyggllpllellvivvvllllllgl
00434521   1/1  M..killvtselpplikvGGlervvlelakaLaarGhevtvvtpgygglladllllle..livlvggrll
00467161   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LDTARHLALGGRYSRFLALPDRWVSWWLGAVPAGLRLIRRYRPQVLWSTYPIATAHLIGLTLHRLSGIPW
00531311   1/1  ........pgvrvvrlpllrlplllrllllllrlrrllrrlkpDvvhahsplp..gllallaarllgipl
00519811   1/1  vllllllvllvllllllllllllrplllllldllllllllalllllalllrrekpDivhahdwlp..gll
00434521   1/1  lvgvlrllldgvkvyrlpapplflrpglpyllpslydyldnalrfalfslaalrrlrrllrrekpDvvha
00467161   1/1  -----------------------------------kvlreekpDvvlvhgdtvstlaaalaakk.lgipv


                         +         -         -         -         -         *         -:210
query           IADFRDSMTEDNYPSNPRVRRAYRAVEAATVHRCTRAIFTAPGAVRMYAERYPERSDKTWVLIENGYEDS
00531311   1/1  vvtlhgllpll...lpgllsrllrlllrlllrradaviavsealaeellelyg.vppekivvipngvdld
00519811   1/1  alllarllgipvvltiHgllplglpsllllgllllllllrllrlllrlalrradaviavSeftaeellkl
00434521   1/1  hdwhs..glaalllklarllgiplvltiHglafqglfpllllsllglpallfglagllrrllrnllraal
00467161   1/1  vhveaglrtfdrysgape.....elnrrlidrladlhfapsefarenllk.egipperifvvg.npvida


                         -         -         -         +         -         -         -:280
query           IFDTVSLPSLRDSPRPFRLVHSGVVYPNERDPRAFFEALASLKRSGQITAQSLQVVFRASGSEDYFRQLL
00531311   1/1  rfrpapdpelraalrerlglpedkpvilfvGrl.vprKgldlllealalllkrlp....dvrlvivGdgp
00519811   1/1  ygvppekivvip.nGvdldrfnpapdkllakarlalrrklglppdkpvilfvGRlelprKgldllleAla
00434521   1/1  rradrviavSetyaeellrlylglglegllgvpaek.ivvipngvdtdlfnpapdpelpvnysadtlegk
00467161   1/1  lfklaekalrppllsrselleklgldpdkkvilvtghrrlnedkg.lelllealaellerl....pdvrl


                         -         *         -         -         -         -         +:350
query           REWGIDDIVHFEPHIPYRGALAEMLTADGLLILQASNCNHQIPAKLYEYLRARRPILGLTDSEGDTARVL
00531311   1/1  lreelealaaelgledrvrflGfvs..d.laelyaaadvfvlpSry..EgfglvllEAmaaGlPvvat..
00519811   1/1  kllkkllgpdvklvivG.dgplreeleklake--------------------------------------
00434521   1/1  lenkaalrerlglpdddkplilfvgRlv.pqKgidlllealarlle......pdvrlvivGdGplreele
00467161   1/1  vivghgntrgrlelikllglpdnvrllgplgyldllallaaadlvvtds........GgvvlEamalGkP


                         -         -         -         -         *         -         -:420
query           RQAGIETVAPLDSAAAITATLQDFLKQLQDGTAPVASEAEIARSSRRSRVASLAECLEETIATDLNFER-
00531311   1/1  dvgglpevvedgetGllveppgdpealaeailrlle..dpelrarlgeaareraee.fswe---------
00519811   1/1  ----------------------------------------------------------------------
00434521   1/1  alaeelglpdrvrflgfvsdeelaelyaaadvfvlP..Sry.EgfGlvllEAmacGlPvvas--------
00467161   1/1  vvvlrdtgerpelvdagtgilvgtdpea------------------------------------------