[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA58511.1


[Show Plain Result]

## Summary of Sequence Search
   1::111
   5::98   3.2e-09 23.4% 0048742 00487421 1/1   domain-like                             
   4::54   0.00064 25.5% 0053365 00533651 1/1   domain-like                             
   1::111


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMRCSIDLRKRVIDFVRGGGSKAEAARRFQVGRASIYRWLSQDDALCYERPGPRRSHKLDWEALRVHVED
00487421   1/1  ----llrvnqlgglfvmgrplsvelRlkivllaaeGlspreiarrlgvsrstvskwlkryretGsvglkp
00533651   1/1  ---lpldlrekivelvkeglrpreiarrlgvslscvskllkryretGslePgai----------------


                         -         -         *         -         -         -         -:140
query           KAALTYKERARHFGVSYYCIWHAMHKMGLTRKKNDGVHAAL-----------------------------
00487421   1/1  rgggrprkltpeqverilellrenpdlt------------------------------------------
00533651   1/1  ----------------------------------------------------------------------