[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA58609.1


[Show Plain Result]

## Summary of Sequence Search
   1::238
  35::210  2.4e-07 20.6% 0048922 00489221 1/1   ike                                     
  36::224  3.2e-07 23.4% 0045819 00458191 1/1   ike                                     
  37::210  4.5e-06 19.9% 0048276 00482761 1/1   ike                                     
  33::206  3.2e-05 20.2% 0049400 00494001 1/1   ike                                     
   1::238


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTEKTGKSLRKPSSSSEVDAFLKKVAAMPQIKPGSRHGRLIFAMDATASREPTWDRACHIQAQMFQETAS
00489221   1/1  ----------------------------------scpldvvfllDvSgSmsg.lelakeallalldaldi
00458191   1/1  -----------------------------------rpldlvfllDvSgSmggsrlelakeallalldala
00482761   1/1  ------------------------------------ppldvvfllDvSgSmggsrlelakeallalldal
00494001   1/1  --------------------------------lerkpldlvfvlDvSgSmgsrlelakdalkslldrl.g


                         -         -         *         -         -         -         -:140
query           LGGLEIQLCYYRGFKEFSASSWLRHSDALLKQMNTVACRGGYTQIEKALQHTQNETRKQKVNALVFVGDC
00489221   1/1  gppgdrvglvtfss.darvlfpltdysdkdellaaldslkylpgggtnlgaaLelalellfsrsagsrpg
00458191   1/1  igpdgdrvglvtfsddarvlfp.ltdykdkdellraldslkyagggtnlgaaLelalellfsraagsrpg
00482761   1/1  d.rpgdrvglvtfss.darvlvpltdlsdkdellealdslkyagggtnlgaaLrlalellfsakagarpg
00494001   1/1  ppgdrvglvtFsssarvlfpltd.dkeellealdslsllyagggtnlgaaLklalellfkgarpgapkvi


                         +         -         -         -         -         *         -:210
query           MEEKMERLCHMAGELGILGVPAFVFQEGYDLVAERAFRQIAQLTQGAYCRFDAASAAQLRDLLNAVAVYA
00489221   1/1  arkviillTDGepndgedlleaarelrekgiriftigilgllllglllddadeelleeiasatggry.vf
00458191   1/1  apkrviilltDGepn...dleeaakelkklgirvftigig.ddadlelleeiaslgggry.vfivddfde
00482761   1/1  arkviilltDGepndgpedlleaakelkklgiriftigigddvsllldlellreiasatggry.vfivdd
00494001   1/1  vlltDGesndgvtdplleaakllkdlgvtiytvgvg..dadeeeleeiaslpgghvfyvd..dfdd----


                         -         -         -         +         -         -         -:280
query           TGGRAALENFSQRQGGVTLRLIHQIKKD------------------------------------------
00489221   1/1  ----------------------------------------------------------------------
00458191   1/1  lpdll.........--------------------------------------------------------
00482761   1/1  ----------------------------------------------------------------------
00494001   1/1  ----------------------------------------------------------------------