[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA58831.1


[Show Plain Result]

## Summary of Sequence Search
   1::261
  92::222  2.4e-36 40.0% 0050646 00506461 1/1   llar hook protein flgE                  
   1::261


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNQALWIAKTGLDAQQTRMATISNNLANVNTTGFKRDRAVFEDLLYQTVRQPGAQSSQNTLLPSGLMLGT
00506461   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GVRTVATEKLFTQGGLTQTGNSLDMAIQGRGFFQILMPDGSLAYTRDGTFQIDANGQLVTSSGYPVQPGI
00506461   1/1  ---------------------plDlAinGdGFFvvsdpdgeilYTRaGsFkldkdgyLvnadGlyllGyp


                         +         -         -         -         -         *         -:210
query           TIPESALSVTVGSDGIVSVLMAGDGTPIQAGNLQLADFINPAGLQPTGNNLFKETASSGVAQTGIPGLNG
00506461   1/1  adadgglldssgglgpiqiptgllpakattnvtlsanLdadatvldvalfdpadlltynystsltvydsl


                         -         -         -         +         -         -         -:280
query           IGTLVQGALEGANVNVVEELVNMIETQRAYEMNSKAISSTDEMLRFATQTL-------------------
00506461   1/1  Gnshtltlyfvk----------------------------------------------------------