[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA58871.1


[Show Plain Result]

## Summary of Sequence Search
   1::200
   1::200  1.4e-60 43.4% 0051705 00517051 1/1   proteins                                
   1::200  4.8e-50 40.1% 0051820 00518201 1/1   proteins                                
   1::198  1.1e-46 32.5% 0043718 00437181 1/1   proteins                                
   1::201  2.5e-40 33.9% 0051281 00512811 1/1   proteins                                
   2::200  9.5e-36 30.9% 0045773 00457731 1/1   proteins                                
   1::168  1.6e-35 34.9% 0044895 00448951 1/1   proteins                                
   2::193  2.4e-35 35.7% 0046862 00468621 1/1   proteins                                
   2::196  2.4e-35 36.3% 0051357 00513571 1/1   proteins                                
   2::197  1.2e-34 34.5% 0036210 00362101 1/1   proteins                                
   1::198  2.4e-34 37.8% 0036778 00367781 1/1   proteins                                
   1::200  3.7e-34 30.1% 0052813 00528131 1/1   proteins                                
   3::175  5.7e-34 26.6% 0049201 00492011 1/1   proteins                                
   3::194  5.9e-33 33.1% 0045274 00452741 1/1   proteins                                
   1::150  6.8e-30 28.7% 0049548 00495481 1/1   proteins                                
   1::145  3.1e-29 28.0% 0049022 00490221 1/1   proteins                                
   1::157  3.8e-29 30.3% 0049640 00496401 1/1   proteins                                
   3::194  7.2e-29 36.3% 0052810 00528101 1/1   proteins                                
   4::194  8.6e-28 36.0% 0053358 00533581 1/1   proteins                                
   1::150  1.2e-23 33.3% 0048535 00485351 1/1   proteins                                
   2::194  3.3e-22 35.7% 0046705 00467051 1/1   proteins                                
   2::197  3.3e-17 31.3% 0051274 00512741 1/1   proteins                                
   1::149  1.7e-15 23.6% 0049507 00495071 1/1   proteins                                
   1::143  6.9e-15 22.5% 0042957 00429571 1/1   proteins                                
   1::150  2.2e-14 22.1% 0046267 00462671 1/1   proteins                                
   2::154  8.7e-13 21.1% 0049241 00492411 1/1   proteins                                
   2::155  1.2e-11 21.7% 0048395 00483951 1/1   proteins                                
   1::145    7e-11 21.0% 0046417 00464171 1/1   proteins                                
   1::109  8.6e-10 30.2% 0035735 00357351 1/1   proteins                                
   1::112  2.6e-07 32.2% 0047543 00475431 1/1   proteins                                
   1::112  4.9e-06 32.9% 0049202 00492021 1/1   proteins                                
   1::94   2.8e-05 30.6% 0049652 00496521 1/1   proteins                                
   4::109  0.00014 28.2% 0051328 00513281 1/1   proteins                                
   1::200


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTKLLVLYYSMYGHVETMAHAVAEGARSVEEVEVTLKRVPELMPEEIARNAGAKLAQEAPIATVDELPEY
00517051   1/1  MmkilvvygSprgnTeklaeaiaegaee.agaevelidvaelplpeclacgdcplk.ddlealledllea
00518201   1/1  MmkiliiygSptGnTeklaeaiaegleavagvevelidvsdadp....................edllea
00437181   1/1  M.KvlviygSprgknsntrklaeaaaeglee..gaevevidladlpippclgcllcalgfkdgkcaqkva
00512811   1/1  aPM.kiliiygSprgnteklaeaiaeglee.agaevelidladlplppclgdlecltegecvlpddveel
00457731   1/1  -mkililYgSltGnTeklAeaiaeglg...gaevelidlddad....................ledleey
00448951   1/1  kkmkkvlivygSmygnteklAeaiaeglke.agvevelldlseldapeile.............lleell
00468621   1/1  -gKililYgSqtGnTeklAeaiaegle.....evdlidldd....................adledlley
00513571   1/1  -AkililygSqtGnTeklAeaiaegleea.gv.velidlde....................adledleea
00362101   1/1  -mkililYgSqtGnTeklAeaiaeglge..gvevdlvdleda....................dledlley
00367781   1/1  mmmkvlivygSmygnteklaeaiaeglre.agvevelidlsdtdldell................eelld
00528131   1/1  llledllllddlpvldldllllidllellimstpm.kilvlygSprrgsntrklaeaaaegleaa.gaev
00492011   1/1  --KiliiygSprkgsntralaeaaaegae.velidladldlppclgdlec.akgkcplpddveallekll
00452741   1/1  --kililYgSqtGnTekvAeaiaeglkaa.glev.lldvdey....................dledledy
00495481   1/1  MkkiliiygSprlkgsntralaeaaaegleealpgaevelidladlplppcdgclecalktgacvlpddv
00490221   1/1  Msm.kiliiygSprkgsntralaeaaaegleea.gaevelidladldldpcldcdlcaakgkcvelltla
00496401   1/1  smmkiliiygSprlkgsntralaeaaaegleealpgaevelidladldlPlldedlcigcfaclkelseg
00528101   1/1  --KvlivYgSmtGnTeklAeaiaeglge.agvevelldladadp....................edllda
00533581   1/1  ---ilivYgSmtGnTeklAeaiaeglee.agvevellnlsdadp....................edlldy
00485351   1/1  MmkilIlYgSqtGnTekvAeaiaeglgaag...velvdlddad....................ledledy
00467051   1/1  -mkililYgSqtGnTeklAeaiaeglee.agvevelldlddldae....................dllae
00512741   1/1  -gekkilvlygSltgntellaealaeglea.agvevelvdladldlpdl................leell
00495071   1/1  M.kiliivgsprkgsntralaeaaaegleeallelhpgaevelidladlnlPlldedllgallcltegqc
00429571   1/1  mmmkiliingspregsntralaeaaleglke.pgaevevidLydlnidpcldcddcaallkppegltlsl
00462671   1/1  mmmkiLiingspregsltraladaalegleeagh.evevidLyalpfdpcldcddcaalftppegltpeq
00492411   1/1  -mkilvivgSlrkgsntrklaeaaaellee..gaevelidladlplplldgdleg..lpddvqellekll
00483951   1/1  -mkilvivGSlrkgsnnrklaealaellee.agaevelidladlnlplldgc......pddvqelrekia
00464171   1/1  mmmkiLiinasprenslsraladaalegleeagh.evevldLydlpfdpcldcddcaakftppegltaeq
00357351   1/1  makililygSqtGnterlAealaeeleaa.glevklldlddl....................dladl..e
00475431   1/1  vllsarllsklkaemakililygSqtGnteelAerlaeeleea.glevevl...................
00492021   1/1  eelllelmakililygSqtGnterlAeklaeellea.gldvklidld.......................
00496521   1/1  akmakililygSqtGnaedlAerlaeel..algfdvkvldlddy....................dledlp
00513281   1/1  ---ililygSqtGnterlAealaelleaa.glevevldlddydled....................llea


                         -         -         *         -         -         -         -:140
query           DAIIFGTPTRFGNMCAQMRNFLDQTGKHWMSGALIGKVGSVFTSTASQHGGQETTITSFHSTLLHQGMVI
00517051   1/1  DgiilGsPtyfgsvsaqlkafldrlsrlwlsgalagKpaavftssggsgggqetallslrtlllhlgmiv
00518201   1/1  DgiilGsPtygggvpgqlkdfldrlsglwl.gllkgKpaavfgsgggsgggfedalkylrkllkelgmiv
00437181   1/1  ddvaelleklleaDaivfgsPvyngsvpaqlKafiDrlsrlgpvgllkgKvvavvttsgg..ggaeaalq
00512811   1/1  leklleaDaiilgtPtyngsvpaqlknflDrvlrlgfggllkgKpaalfgtsggpgggaerallqlrtil
00457731   1/1  daiilgtptygygelpdnlkdfldellgld....lsgkkvavFglgdssgggeefcealklldkllaelg
00448951   1/1  dadalilgsPtyggeippqlkdfldllggla....lkgKlaavfgsggwfggavkt....leellkelga
00468621   1/1  daiilgtpTygfGelpdnakdfldalkgld....lkgkkyavfgl.Gdsggypetfctalklldell.lg
00513571   1/1  daiifgtptygfGelpdnlkafldrtfydfleglkglllkgkkyavfglgdslgygeefcaaakkldkll
00362101   1/1  daiilgtptygygelpdnlkdfldfllkld....lkgkkvavfglgdssggyeefcaalkkldkrlaelG
00367781   1/1  adaiilGsPtynggvlpqlknfldalsgld....lkgKpvavfgs....gggsgeavdllrellkelgak
00528131   1/1  eiidladlplplgcidclp.....ddvaelledllaadgivvgsPtyngsmpallKnflDrllllggsvg
00492011   1/1  aaDaivfgtPeyngsvpaqlKnfiDrvsrlgfafgydgpggllkgKpaalvvtsggpgggylesalrylr
00452741   1/1  dllilgtpTygfGelpdnaksfldellglrlakldlsgkkvavFglgdssgyyeeFcaaakkldkllael
00495481   1/1  qallalsdallekllaaDaivfgtPeyngsvpallKnfiDrvlragfafgytglggggllkgKpaalivt
00490221   1/1  qeellalkegllpddvaellekllaaDaivfgtPvyngsvpaqlKnfiDrvlragfafgygglgpvgllk
00496401   1/1  ecvlpddvaallekllaaDaivfgtPeyngsvpallKnfiDrvlrpgfafgygglgpvgllkgKpaalvv
00528101   1/1  dalilgtptygggelpddlvkdfldll.....kldlkgkkvavfgsggs.gfgd..alklldellkelga
00533581   1/1  daiilgsptygggeppedevkdfldrllg.....klkgkkvavfgsggs.gfge..alklleellkelga
00485351   1/1  dliilgtptygagelpdnlkdfldelkeld....lsgkkvavFglgdssryygwfgeavklldkllkelg
00467051   1/1  ydlvilgtptyggGeeelpdnakdfldalkeld....lkgkkvavfglGdssygwfcgaaklldelleel
00512741   1/1  dadalvVgsPtyngsipgllkafldrllglg....lkgkkvavfgsgg....gsggavkqlrellaelga
00495071   1/1  alpddvaeliekllaaDalvfvtPeYngsiPalLKnfiDrvsrp.....lkgKpvllvstsgg...gglr
00429571   1/1  eealalgecalpddveellekllaaDaivfafPlYwfsvPallKnfiDrvlragfafgytgngpegllkg
00462671   1/1  kqalalgkcplpddvealqekllaADaivfafPlywfsvPallKgwiDrvlraGfafgyggngpvgllkg
00492411   1/1  aaDglvfatPeYngsipglLKnalDrlsrpggk.llagKpvalvstsggalgg.lraleqlrlilgflga
00483951   1/1  eaDaivlvtPeYngsipgaLKnalDwlsrpw....lagkpvalvavsgggsgglraleqlrqvlaflgal
00464171   1/1  eealalgecvlkddvaeeqekllaADvivfafPlywfgvPalLKgwiDrvlragfafgytgdgp.vgllk
00357351   1/1  dllllvtsTygeGeppdnakdflealldlkaldlsglry-------------------------------
00475431   1/1  ...dlddldlddllladlpkydllilvtsTygdGelpdnaed----------------------------
00492021   1/1  .........lilvtsTygeGelpdnaldflel.........l----------------------------
00496521   1/1  eedlvlfvtsTyGdGepPdnaedf----------------------------------------------
00513281   1/1  dllllvtsTygdGelpdnaldflellldlkapdlsglry-------------------------------


                         +         -         -         -         -         *         -:210
query           VGVPYSCQALLNMNEITGGSPYGASTLADADGSRQPSENELTIARFQGEHVAKFTKKVVE----------
00517051   1/1  vglglavgg..lldefrggspygastfagidggvlpdeeeletarelgkrlaelakklkg----------
00518201   1/1  vglgyfagal.......ggspygallaeg.....apdeedlerarelgkrlaellkklkg----------
00437181   1/1  ylrtilaflgmivvglvyaegvll.gpgdevllgsaygafdvag.dgvdepdeealer------------
00512811   1/1  aflgmivvglglaigvafda....fgaplgastlaggv...lldedelelarllgerlael---------
00457731   1/1  akvvgegllad....ydfeasfalwldglfiglal...peeedlelaeefgkrlaellkk----------
00448951   1/1  kvvplleikgsptdleeleelgkelakt------------------------------------------
00468621   1/1  akrlgplvlad.aldeedllewlkklaglladldglptlteeeleltvlqlve-----------------
00513571   1/1  lelgakvvglglidgydleedliewlgsllgaltdalnlieltdsrvelwvaqilg--------------
00362101   1/1  akrvgegllidysfddskavlggsfvglal....dedn.pdeedleraeewgkrlae-------------
00367781   1/1  vvgepllv.........................kgapdeedletaeelgkrlaellkk------------
00528131   1/1  llagKpaavfvtggg..sggelaleqlrtllahlgmivvppglsvgvagltf........----------
00492011   1/1  tilaflgmtvvgsvyaegv..dfgevekdeealer-----------------------------------
00452741   1/1  Gakrvglllegdydfeasdavlggsfvgll....ldgdrqpdeteeriaewlek----------------
00495481   1/1  sggpggglaa------------------------------------------------------------
00490221   1/1  gKpaa-----------------------------------------------------------------
00496401   1/1  tsggpggglaaetalrp-----------------------------------------------------
00528101   1/1  kvvg............................egliipdeedlekarelgkrla----------------
00533581   1/1  kvvglpllag..........................vpdeedlerarelgkrla----------------
00485351   1/1  akvvgeglfi------------------------------------------------------------
00467051   1/1  gakrvgel.........................ldidvqpdetdleaaeewgeq----------------
00512741   1/1  lvvplgvllv........................dedpdeealerieelgeelakll-------------
00495071   1/1  allylrtil-------------------------------------------------------------
00429571   1/1  Kkv-------------------------------------------------------------------
00462671   1/1  KkalvivtsG------------------------------------------------------------
00492411   1/1  vvvpsvvvalgkal--------------------------------------------------------
00483951   1/1  vipsqvlilgagfde-------------------------------------------------------
00464171   1/1  gKkal-----------------------------------------------------------------
00357351   1/1  ----------------------------------------------------------------------
00475431   1/1  ----------------------------------------------------------------------
00492021   1/1  ----------------------------------------------------------------------
00496521   1/1  ----------------------------------------------------------------------
00513281   1/1  ----------------------------------------------------------------------