[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA58880.1


[Show Plain Result]

## Summary of Sequence Search
   1::163
  26::159  3.9e-31 32.3% 0041150 00411501 1/1   ed helix" DNA-binding domain            
  36::95   3.4e-09 34.5% 0043935 00439351 1/1   ed helix" DNA-binding domain            
  33::116  1.1e-07 28.0% 0048703 00487031 1/1   ed helix" DNA-binding domain            
  39::94   3.2e-06 33.3% 0040266 00402661 1/1   ed helix" DNA-binding domain            
  35::95   7.6e-06 32.2% 0041905 00419051 1/1   ed helix" DNA-binding domain            
  35::93   7.7e-06 28.1% 0051024 00510241 1/1   ed helix" DNA-binding domain            
  32::95   2.1e-05 30.6% 0052506 00525061 1/1   ed helix" DNA-binding domain            
  36::94     3e-05 33.3% 0049363 00493631 1/1   ed helix" DNA-binding domain            
  37::107  0.00012 21.1% 0047587 00475871 1/1   ed helix" DNA-binding domain            
  35::96   0.00017 31.7% 0045981 00459811 1/1   ed helix" DNA-binding domain            
  39::96   0.00027 32.1% 0052364 00523641 1/1   ed helix" DNA-binding domain            
  41::95   0.00073 28.3% 0051302 00513021 1/1   ed helix" DNA-binding domain            
   1::163


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSHTNILVPFKGPSHDHWRCIRNALAVAEKTCASRGLRLTKLRRRVLELIWDRHEPAKAYDILEQLRQEH
00411501   1/1  -------------------------eealellkeaglrlTpqRlavlelLleasdrhlsaeeiyeelrer
00439351   1/1  -----------------------------------glgltplqlliLllLaegpg.ltvyelaerlg.gl
00487031   1/1  --------------------------------llkllklseleleilrlLwklg.pltvkeiaeel.eee
00402661   1/1  --------------------------------------iflllraarllikllgellkrlglsptrlriL
00419051   1/1  ----------------------------------kelgltplelevllvLwekg.pltvkelaeelgeel
00510241   1/1  ----------------------------------kelllgllqlliLalLae..gplygyelaklleell
00525061   1/1  -------------------------------rivlelllgklrlliLalLae..gplhgyeLakrleels
00493631   1/1  -----------------------------------mlkLtelelevllvlwelg.pitvkeiaeel.eek
00475871   1/1  ------------------------------------lkLterqleildfileyieengyppsvreiaeal
00459811   1/1  ----------------------------------llellerllrlllkgflrlliLllLa..eeplyGye
00523641   1/1  --------------------------------------raaraliellaellkalgldptrlriLllLle
00513021   1/1  ----------------------------------------slrlliLglLae..gpmhgyelakeleerl


                         -         -         *         -         -         -         -:140
query           QAAAPPTVYRALDFLLQTGLIHRVETLNAYVGCGDPDRLHIGQFLLCRRCGTVAELDAPEITGIITREAK
00411501   1/1  gpgislaTVYrtLdlLeeaglvrrlelgggkaryeltte.ghhhhlicldcgkvieleddlleelllela
00439351   1/1  lslspgtvyrllkrLekeGlverrr---------------------------------------------
00487031   1/1  lglspstvstlLkrLeekglverekegrayiYsalvskeeylalll------------------------
00402661   1/1  alLaesdgpltvselaeelg....----------------------------------------------
00419051   1/1  d.lspstvttllkrLekkGlverek---------------------------------------------
00510241   1/1  ggllgisegtlypaLkrLekkgl-----------------------------------------------
00525061   1/1  lgllpgispgtlypaLkrLeedGlv---------------------------------------------
00493631   1/1  rglsystvttllkrLekkglvere----------------------------------------------
00475871   1/1  glkspstvhshLkaLekkGyierlpgksraielldlp---------------------------------
00459811   1/1  likeleellggfgwkpspgtlYptLh--------------------------------------------
00523641   1/1  ngepltvseLaell.....glskstv--------------------------------------------
00513021   1/1  ggfwgispgtlypaLkrLeeeGlve---------------------------------------------


                         +         -         -         -         -         *         -:210
query           YLGFRVDRQTVEIRGLCPQCSGD-----------------------------------------------
00411501   1/1  eklgfklldhelelyGlCp---------------------------------------------------
00439351   1/1  ----------------------------------------------------------------------
00487031   1/1  ----------------------------------------------------------------------
00402661   1/1  ----------------------------------------------------------------------
00419051   1/1  ----------------------------------------------------------------------
00510241   1/1  ----------------------------------------------------------------------
00525061   1/1  ----------------------------------------------------------------------
00493631   1/1  ----------------------------------------------------------------------
00475871   1/1  ----------------------------------------------------------------------
00459811   1/1  ----------------------------------------------------------------------
00523641   1/1  ----------------------------------------------------------------------
00513021   1/1  ----------------------------------------------------------------------