[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA58884.1


[Show Plain Result]

## Summary of Sequence Search
   1::193
  87::194  2.8e-44 58.9% 0051208 00512081 1/1    superoxide dismutase (SOD), C-terminal 
  84::195  3.8e-44 59.8% 0040860 00408601 1/1    superoxide dismutase (SOD), C-terminal 
  84::195    1e-43 59.5% 0039719 00397191 1/1    superoxide dismutase (SOD), C-terminal 
  81::195  4.3e-43 58.3% 0050425 00504251 1/1    superoxide dismutase (SOD), C-terminal 
  84::194  6.3e-43 57.7% 0038283 00382831 1/1    superoxide dismutase (SOD), C-terminal 
  84::194  9.2e-43 62.2% 0049959 00499591 1/1    superoxide dismutase (SOD), C-terminal 
  84::194  1.1e-42 60.4% 0038985 00389851 1/1    superoxide dismutase (SOD), C-terminal 
  84::193  1.5e-42 60.0% 0039180 00391801 1/1    superoxide dismutase (SOD), C-terminal 
  84::194  1.5e-42 58.6% 0041014 00410141 1/1    superoxide dismutase (SOD), C-terminal 
  81::194  2.2e-42 61.4% 0035287 00352871 1/1    superoxide dismutase (SOD), C-terminal 
  85::194  3.3e-42 60.0% 0036585 00365851 1/1    superoxide dismutase (SOD), C-terminal 
  85::191  4.4e-42 61.7% 0042885 00428851 1/1    superoxide dismutase (SOD), C-terminal 
  84::193  1.8e-41 60.6% 0041143 00411431 1/1    superoxide dismutase (SOD), C-terminal 
  84::194  2.1e-41 61.5% 0036081 00360811 1/1    superoxide dismutase (SOD), C-terminal 
  80::194  2.3e-41 61.9% 0040124 00401241 1/1    superoxide dismutase (SOD), C-terminal 
  86::195  2.4e-41 61.5% 0038820 00388201 1/1    superoxide dismutase (SOD), C-terminal 
  86::194  2.7e-41 60.6% 0042186 00421861 1/1    superoxide dismutase (SOD), C-terminal 
  84::194  2.9e-41 60.4% 0035696 00356961 1/1    superoxide dismutase (SOD), C-terminal 
  84::191  3.1e-41 62.6% 0045567 00455671 1/1    superoxide dismutase (SOD), C-terminal 
  84::194  1.2e-40 60.4% 0035152 00351521 1/1    superoxide dismutase (SOD), C-terminal 
   1::83   1.9e-37 54.2% 0038282 00382821 1/1    superoxide dismutase (SOD), N-terminal 
   1::85   1.6e-36 50.6% 0035695 00356951 1/1    superoxide dismutase (SOD), N-terminal 
   1::84   2.1e-36 50.0% 0042884 00428841 1/1    superoxide dismutase (SOD), N-terminal 
   2::83     5e-36 53.7% 0039179 00391791 1/1    superoxide dismutase (SOD), N-terminal 
   2::83   3.8e-35 56.1% 0039718 00397181 1/1    superoxide dismutase (SOD), N-terminal 
   1::83   3.9e-35 54.2% 0049958 00499581 1/1    superoxide dismutase (SOD), N-terminal 
   1::83   1.3e-34 50.6% 0040123 00401231 1/1    superoxide dismutase (SOD), N-terminal 
   1::83   2.8e-34 55.4% 0041013 00410131 1/1    superoxide dismutase (SOD), N-terminal 
   2::84   4.1e-34 51.8% 0036584 00365841 1/1    superoxide dismutase (SOD), N-terminal 
   1::83   4.3e-34 53.0% 0038984 00389841 1/1    superoxide dismutase (SOD), N-terminal 
   1::85   6.4e-34 54.1% 0040859 00408591 1/1    superoxide dismutase (SOD), N-terminal 
   2::83   1.5e-33 53.7% 0041142 00411421 1/1    superoxide dismutase (SOD), N-terminal 
   2::83   2.3e-33 57.3% 0038819 00388191 1/1    superoxide dismutase (SOD), N-terminal 
   1::87   5.3e-33 51.7% 0042185 00421851 1/1    superoxide dismutase (SOD), N-terminal 
   2::83   7.5e-33 53.7% 0035151 00351511 1/1    superoxide dismutase (SOD), N-terminal 
   1::82   6.1e-31 53.7% 0035286 00352861 1/1    superoxide dismutase (SOD), N-terminal 
   1::82   7.1e-31 50.0% 0050424 00504241 1/1    superoxide dismutase (SOD), N-terminal 
   2::82     1e-30 50.6% 0051207 00512071 1/1    superoxide dismutase (SOD), N-terminal 
   1::83   9.7e-30 48.8% 0036080 00360801 1/1    superoxide dismutase (SOD), N-terminal 
   1::193


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTHRLPELPYALNALEPHISQETLEYHYGKHHQTYVDKLNGLVPGTEFENASLEEIITKASGTLFNNGAQ
00512081   1/1  ----------------------------------------------------------------------
00408601   1/1  ----------------------------------------------------------------------
00397191   1/1  ----------------------------------------------------------------------
00504251   1/1  ----------------------------------------------------------------------
00382831   1/1  ----------------------------------------------------------------------
00499591   1/1  ----------------------------------------------------------------------
00389851   1/1  ----------------------------------------------------------------------
00391801   1/1  ----------------------------------------------------------------------
00410141   1/1  ----------------------------------------------------------------------
00352871   1/1  ----------------------------------------------------------------------
00365851   1/1  ----------------------------------------------------------------------
00428851   1/1  ----------------------------------------------------------------------
00411431   1/1  ----------------------------------------------------------------------
00360811   1/1  ----------------------------------------------------------------------
00401241   1/1  ----------------------------------------------------------------------
00388201   1/1  ----------------------------------------------------------------------
00421861   1/1  ----------------------------------------------------------------------
00356961   1/1  ----------------------------------------------------------------------
00455671   1/1  ----------------------------------------------------------------------
00351521   1/1  ----------------------------------------------------------------------
00382821   1/1  lllllslllllmaftlppLpYdydaLePlisaetlelhhgkhhqtYvnnlnkaleglaelegksleelil
00356951   1/1  maftlpplpYdydalePliseetlelhhdkhhqtyvnnlnaaleglelagksleelilaalkaalfnnag
00428841   1/1  mlftlpplpYdydalePlisaetlelhhdkhhqayvnnlnaaleglelegksleelilalqaalfnnagg
00391791   1/1  -lftlpelpYdydalePlisaetlelhhdkhhqtyvnnlnaaleglelegksleelilallgalfnnagg
00397181   1/1  -aftlpeLpYdydalePlisaetlelhhgkhhqtyvnnlnaaleglaelegksleelilalaslpekleg
00499581   1/1  elrmlftlpeLpYdydaLeplisaetlelhhgkhhqayvdnlnaalegtelagksleeillltaldalqa
00401231   1/1  mafelpplpYdydalePlisaetlelHhgkhhqayvnnlnaaleglelagksleelillslkaalfnnag
00410131   1/1  lmaftlpelpYdydalePlisaetlelHhgkhhqtYvnnlnaalegleelegksleelilnllglllalk
00365841   1/1  -lftlpelpYdydalePlisaetlelhhdkhhqayvnnlnaalegleledksleeiilallgavfnnagg
00389841   1/1  maftlpelpYdydaLePlisaetlelHhgkhhqaYvnnlnaaleglelaglslellillslsgalfnnag
00408591   1/1  llmafelpelpYdydalePlisaetlelHhgkhhqayvnnlnaaleglelaglsleelillslsgalfnn
00411421   1/1  -aftlpplpyaydalepylisaetlelhhdkhhqtyVnnlnaalegtelagksleeiilasaldalqaal
00388191   1/1  -afelpelpYaydalePlisaetlelHhgkhhqtYvnnlnaaleglaelegksleelilalsglpedlkl
00421851   1/1  llllmafelpplpydydaLePviseetlelHhgkhhqtyvnnlnaaleglelldlsleelllaslkralf
00351511   1/1  -afelpdlpYaydalePlisaetlelHhgkhhqtYvnnlnaaleglelaglsleellllslegalfnnaa
00352861   1/1  llllmafelpelpYdydalePlisaetlelHhgkhhqtYvnnlnkaleglaelagksleelilallglpl
00504241   1/1  lllmaftlpdlpYdydalePlisaetlelHhgkhhqaYvnnlnkaleglaelagksleelillladlqta
00512071   1/1  -lftlpeLpYdydaLePlisaetlelhhgkhhqaYvnnlnkaleglelagksleelllgllgllldlqta
00360801   1/1  mlfelpplpydydaLeP.iseetlelHydkhhqgYvnnlnkalek..laelsleelikalanvselkglk


                         -         -         *         -         -         -         -:140
query           VWNHTFYWNCLTPQGGGEPSGALLEAIEKNFGSFSDFKEKFSQSATTLFGSGWAWLVKNSDGSLDIVGTS
00512081   1/1  ----------------gepsgelaeaieedfgsfeafkeeflaaalglfGsGWawLvldd.gkllilsta
00408601   1/1  -------------ggggepsgelaeaiekdFgsfeefkeeflaaalglfGsGWawLvldkldgkLvivtt
00397191   1/1  -------------ggggepsgelaeaiekdFgsfeefkeeflaaalglfGsGWawLvldk.gkllivtta
00504251   1/1  ----------llpggggepsgelaeaieedfgsfekfkeeflaaalglfGsGWawLvldkldgklviltt
00382831   1/1  -------------ggggepsgelaeaieedFgsfeefkeeflaaalglfGsGWawLvldkegklliltta
00499591   1/1  -------------ggggepsgelleaiekdfgsfeafkeeflaaalgvfGsGWawLvldkdsslsllltl
00389851   1/1  -------------ggggepsgelaeaiekdFgsfeefkeeflaaalglfGsGWawLvldkldgkLvivtt
00391801   1/1  -------------ggggepsgelaeaiekdFgsfeefkeeflaaalglfGsGWawLvldkdgklliltta
00410141   1/1  -------------ggggepsgelaeaiekdFgsfeefkeeflaaalglfGsGWawLvldkegklliltta
00352871   1/1  ----------llpggggepsgelaeaiekdFgsfeafkeeflaaalglfGsGWawLvldkldgkLvivtt
00365851   1/1  --------------gggepsgelaeaiekdFgsfeefkeeflaaalglfGsGWawLvldklgklliltta
00428851   1/1  --------------gggepsgelaeaiekdFgsfeefkeeflaaalglfGsGWawLvldkdgkllilsta
00411431   1/1  -------------ggggepsgelaeaiekdFgsfeefkeeflaaalglfGsGWawLvldk.gkleiltta
00360811   1/1  -------------ggggepsgelaeaiekdFgsfeefkeeflaaa..vfgsGWawLvldpldgkLvivtt
00401241   1/1  ---------lllpggggepsgelaeaiekdFgsfeefkeeflaaalglfGsGWawLvldkldgkLvivtt
00388201   1/1  ---------------ggepsgelaeaiekdFgsfeefkeeflaaalglfGsGWawLvldk.gkleivtta
00421861   1/1  ---------------ggepsgelaeaiekdFgsfeefkeeflaaalglfGsGWawLvldkldgkLlivtt
00356961   1/1  -------------ggggepsgelaeaiekdFgsfeefkeeflaaalglfGsGWawLvldkldgkLeivtt
00455671   1/1  -------------ggggepsgelaeaiekdfgsfeefkeeflaaalglfGsGWawLvldk.gkleivtta
00351521   1/1  -------------ggggepsgelaeaiekdFgsfeefkeeflaaalglfGsGWawLvldpldgkLvivtt
00382821   1/1  alasllealqgal---------------------------------------------------------
00356951   1/1  ghlnHslfWeslsPn-------------------------------------------------------
00428841   1/1  hlnHslFWksLsPn--------------------------------------------------------
00391791   1/1  hlnHslFWksLsP---------------------------------------------------------
00397181   1/1  alfnnagghlnHs---------------------------------------------------------
00499581   1/1  alfnnagghlnHs---------------------------------------------------------
00401231   1/1  ghlnHslfWksls---------------------------------------------------------
00410131   1/1  lalfnnagghlnH---------------------------------------------------------
00365841   1/1  hlnHslFWksLsPn--------------------------------------------------------
00389841   1/1  ghlnHslfWksls---------------------------------------------------------
00408591   1/1  agghlnHslfWksls-------------------------------------------------------
00411421   1/1  fnnagghlnHslF---------------------------------------------------------
00388191   1/1  alfnnagghlnHs---------------------------------------------------------
00421851   1/1  nnagghinHslfWesls-----------------------------------------------------
00351511   1/1  ghlnHslfWklls---------------------------------------------------------
00352861   1/1  alfnnagghlnH----------------------------------------------------------
00504241   1/1  lfnnagghlnHs----------------------------------------------------------
00512071   1/1  lfnnagghlnHs----------------------------------------------------------
00360801   1/1  relffnagghlnH---------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NAGNPLTEGKTPLLTCDVWEHAYYIDYRNARPKYLEAFWKLANWDFVAKNLAN-----------------
00512081   1/1  nqdtplllarllglglvPlLaldvwehaYyldYgnrradYveafwnvvnWdvve----------------
00408601   1/1  anqdtplllglvPlLaldvwehaYyldYgnrradYveafwnvvnWdlveerleaa---------------
00397191   1/1  nqdtplllglvPllaldvwehaYyldYgnrradYveafwnvvnWdvveerllaal---------------
00504251   1/1  anqdtplllglvPlLgldvwehaYyldygnrradYveafwnvvnWdvveerleaa---------------
00382831   1/1  nqdtplllglvPllaldvwehaYyldYgnrradYveafwnvvnWdvveerllaa----------------
00499591   1/1  lagspllgklvivstanqdtpllglglvPlLalDvwehaYyldYgngradYlea----------------
00389851   1/1  anqdtplllglvPlLaldvwehaYyldYgnrradYveafwnvvnWdvveerlla----------------
00391801   1/1  nqdtplllglvPllaldvwehaYyldYgnrradYveafwnvvnWdvveerllk-----------------
00410141   1/1  nqdtplllglvPllaldvwehaYyldYgnrradYveafwnvvnWdvveerllka----------------
00352871   1/1  anadsplllglvPlLaldvwehaYyldYgnrradYveafwnvvnWdvveerlea----------------
00365851   1/1  nadtplllglvPlLaldvwehAYyldYgnrradYveafwnvvnWdvveerllaa----------------
00428851   1/1  nadtplllglvPllaldvwehaYyldygnrradYveafwnvvnWdvveerf-------------------
00411431   1/1  nadsplllglvPlLaldvwehaYyldygnrradYveafwnevvnWdvveerll-----------------
00360811   1/1  anadtplllglvPlLalDvwehAYyldYgnrradYveafwnvvnWdvveerlla----------------
00401241   1/1  anadtpl..glvPllaldvwehaYyldYgnrradYveafwnvvnWdvveerlla----------------
00388201   1/1  nadtplllarllelglvPlLaldvwehaYyldYgnrradYveafwnvvnWdvvee---------------
00421861   1/1  anqdsplllglvPlLaldvwehaYyldYgnrradYveafwnvvnWdvveerlla----------------
00356961   1/1  anqdtplllglvPlLaldvwehaYyldYgnrradYveafwnvvnWdvveerlla----------------
00455671   1/1  nadtplllglvPllaldvwehaYyldygnrradYveafwnvvnWdlveerl-------------------
00351521   1/1  anqdtpllllglvPlLaldvwehaYyldYgnrradYveafwnvvnWdvveerll----------------
00382821   1/1  ----------------------------------------------------------------------
00356951   1/1  ----------------------------------------------------------------------
00428841   1/1  ----------------------------------------------------------------------
00391791   1/1  ----------------------------------------------------------------------
00397181   1/1  ----------------------------------------------------------------------
00499581   1/1  ----------------------------------------------------------------------
00401231   1/1  ----------------------------------------------------------------------
00410131   1/1  ----------------------------------------------------------------------
00365841   1/1  ----------------------------------------------------------------------
00389841   1/1  ----------------------------------------------------------------------
00408591   1/1  ----------------------------------------------------------------------
00411421   1/1  ----------------------------------------------------------------------
00388191   1/1  ----------------------------------------------------------------------
00421851   1/1  ----------------------------------------------------------------------
00351511   1/1  ----------------------------------------------------------------------
00352861   1/1  ----------------------------------------------------------------------
00504241   1/1  ----------------------------------------------------------------------
00512071   1/1  ----------------------------------------------------------------------
00360801   1/1  ----------------------------------------------------------------------