[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA59023.1


[Show Plain Result]

## Summary of Sequence Search
   1::212
  28::207  8.3e-46 39.4% 0046568 00465681 1/1   nosyl-L-methionine-dependent methyltran 
   1::207  9.7e-37 34.4% 0047945 00479451 1/1   nosyl-L-methionine-dependent methyltran 
   7::203  2.7e-34 33.1% 0048805 00488051 1/1   nosyl-L-methionine-dependent methyltran 
  32::206  1.2e-28 30.6% 0050519 00505191 1/1   nosyl-L-methionine-dependent methyltran 
   4::206  3.1e-28 31.1% 0037982 00379821 1/1   nosyl-L-methionine-dependent methyltran 
   2::210  1.3e-22 30.8% 0048438 00484381 1/1   nosyl-L-methionine-dependent methyltran 
   4::161  1.8e-19 29.1% 0052001 00520011 1/1   nosyl-L-methionine-dependent methyltran 
  14::205  5.9e-18 30.8% 0046744 00467441 1/1   nosyl-L-methionine-dependent methyltran 
  49::207  8.5e-16 32.4% 0049915 00499151 1/1   nosyl-L-methionine-dependent methyltran 
   3::186  1.7e-15 28.6% 0046696 00466961 1/1   nosyl-L-methionine-dependent methyltran 
  10::188  5.1e-15 25.0% 0047386 00473861 1/1   nosyl-L-methionine-dependent methyltran 
  15::189  9.6e-15 29.6% 0052807 00528071 1/1   nosyl-L-methionine-dependent methyltran 
  13::200  2.9e-14 28.7% 0047329 00473291 1/1   nosyl-L-methionine-dependent methyltran 
   4::199  6.8e-14 24.4% 0049074 00490741 1/1   nosyl-L-methionine-dependent methyltran 
  47::211  1.1e-13 31.4% 0051261 00512611 1/1   nosyl-L-methionine-dependent methyltran 
   1::204    2e-13 27.1% 0040196 00401961 1/1   nosyl-L-methionine-dependent methyltran 
   3::200  2.6e-13 25.7% 0046840 00468401 1/1   nosyl-L-methionine-dependent methyltran 
  11::186  4.4e-13 30.0% 0046931 00469311 1/1   nosyl-L-methionine-dependent methyltran 
  17::178    5e-13 28.5% 0046354 00463541 1/1   nosyl-L-methionine-dependent methyltran 
  49::201    7e-13 31.6% 0047471 00474711 1/1   nosyl-L-methionine-dependent methyltran 
  20::207  8.1e-13 27.4% 0040829 00408291 1/1   nosyl-L-methionine-dependent methyltran 
  48::187  8.9e-13 30.4% 0048490 00484901 1/1   nosyl-L-methionine-dependent methyltran 
  49::163  2.3e-12 37.0% 0051944 00519441 1/1   nosyl-L-methionine-dependent methyltran 
   2::188  3.4e-12 25.4% 0049122 00491221 1/1   nosyl-L-methionine-dependent methyltran 
   7::204  3.4e-12 25.0% 0046838 00468381 1/1   nosyl-L-methionine-dependent methyltran 
  47::196  3.9e-12 32.8% 0051884 00518841 1/1   nosyl-L-methionine-dependent methyltran 
   7::199  4.4e-12 23.4% 0047919 00479191 1/1   nosyl-L-methionine-dependent methyltran 
  10::191  4.8e-12 25.7% 0051823 00518231 1/1   nosyl-L-methionine-dependent methyltran 
  33::200  5.7e-12 31.1% 0050234 00502341 1/1   nosyl-L-methionine-dependent methyltran 
   9::192  9.2e-12 29.3% 0047580 00475801 1/1   nosyl-L-methionine-dependent methyltran 
  49::208  1.3e-11 28.2% 0051885 00518851 1/1   nosyl-L-methionine-dependent methyltran 
  14::207  1.7e-11 24.1% 0047923 00479231 1/1   nosyl-L-methionine-dependent methyltran 
   8::163  1.8e-11 28.4% 0047465 00474651 1/1   nosyl-L-methionine-dependent methyltran 
   5::192  1.9e-11 25.2% 0043085 00430851 1/1   nosyl-L-methionine-dependent methyltran 
   4::200  2.5e-11 21.1% 0040327 00403271 1/1   nosyl-L-methionine-dependent methyltran 
  42::198    3e-11 29.3% 0049532 00495321 1/1   nosyl-L-methionine-dependent methyltran 
  49::207  9.2e-11 28.0% 0050988 00509881 1/1   nosyl-L-methionine-dependent methyltran 
  47::180  2.2e-10 28.8% 0049474 00494741 1/1   nosyl-L-methionine-dependent methyltran 
   9::204  3.3e-10 25.4% 0052709 00527091 1/1   nosyl-L-methionine-dependent methyltran 
  44::204  4.3e-10 30.5% 0049885 00498851 1/1   nosyl-L-methionine-dependent methyltran 
   1::204    5e-10 23.6% 0051103 00511031 1/1   nosyl-L-methionine-dependent methyltran 
  47::197  6.5e-10 27.6% 0049671 00496711 1/1   nosyl-L-methionine-dependent methyltran 
  47::188  9.4e-10 28.1% 0039093 00390931 1/1   nosyl-L-methionine-dependent methyltran 
  28::187    1e-09 26.7% 0051449 00514491 1/1   nosyl-L-methionine-dependent methyltran 
   7::197  1.5e-09 22.7% 0049719 00497191 1/1   nosyl-L-methionine-dependent methyltran 
   1::200  2.6e-09 22.9% 0044689 00446891 1/1   nosyl-L-methionine-dependent methyltran 
  35::186    4e-09 28.8% 0051143 00511431 1/1   nosyl-L-methionine-dependent methyltran 
  49::194  4.9e-09 29.5% 0047851 00478511 1/1   nosyl-L-methionine-dependent methyltran 
  49::207  5.9e-09 23.5% 0047676 00476761 1/1   nosyl-L-methionine-dependent methyltran 
  48::190  7.7e-09 31.1% 0051930 00519301 1/1   nosyl-L-methionine-dependent methyltran 
  12::164  1.6e-08 27.3% 0050154 00501541 1/1   nosyl-L-methionine-dependent methyltran 
  48::191  2.6e-08 25.2% 0052649 00526491 1/1   nosyl-L-methionine-dependent methyltran 
  49::191  2.8e-08 29.2% 0050745 00507451 1/1   nosyl-L-methionine-dependent methyltran 
  47::197  4.7e-08 26.4% 0050242 00502421 1/1   nosyl-L-methionine-dependent methyltran 
   8::204  5.4e-08 29.9% 0049171 00491711 1/1   nosyl-L-methionine-dependent methyltran 
   1::204  7.3e-08 29.3% 0045060 00450601 1/1   nosyl-L-methionine-dependent methyltran 
  47::163  7.3e-08 33.9% 0049442 00494421 1/1   nosyl-L-methionine-dependent methyltran 
  47::124  7.5e-08 28.9% 0047211 00472111 1/1   nosyl-L-methionine-dependent methyltran 
  12::207  1.4e-07 25.1% 0050762 00507621 1/1   nosyl-L-methionine-dependent methyltran 
   1::187  2.8e-07 22.8% 0042197 00421971 1/1   nosyl-L-methionine-dependent methyltran 
  15::122  3.9e-07 26.7% 0052894 00528941 1/1   nosyl-L-methionine-dependent methyltran 
   1::204    4e-07 28.7% 0051842 00518421 1/1   nosyl-L-methionine-dependent methyltran 
  15::178  6.5e-07 24.0% 0052182 00521821 1/1   nosyl-L-methionine-dependent methyltran 
   1::189    7e-07 26.8% 0041326 00413261 1/1   nosyl-L-methionine-dependent methyltran 
  13::204  8.2e-07 24.4% 0053077 00530771 1/1   nosyl-L-methionine-dependent methyltran 
  10::100  2.4e-06 29.3% 0041444 00414441 1/1   nosyl-L-methionine-dependent methyltran 
  11::187  2.4e-06 27.1% 0035026 00350261 1/1   nosyl-L-methionine-dependent methyltran 
  16::124  2.4e-06 31.6% 0048629 00486291 1/1   nosyl-L-methionine-dependent methyltran 
  33::124  4.7e-06 39.2% 0051617 00516171 1/1   nosyl-L-methionine-dependent methyltran 
   4::164  5.1e-06 28.1% 0050935 00509351 1/1   nosyl-L-methionine-dependent methyltran 
   6::206  7.1e-06 25.3% 0051679 00516791 1/1   nosyl-L-methionine-dependent methyltran 
  19::121  8.9e-06 27.1% 0049186 00491861 1/1   nosyl-L-methionine-dependent methyltran 
  11::205  1.4e-05 20.8% 0040964 00409641 1/1   nosyl-L-methionine-dependent methyltran 
  47::175  4.1e-05 29.5% 0044550 00445501 1/1   nosyl-L-methionine-dependent methyltran 
  49::209  4.2e-05 23.4% 0053087 00530871 1/1   nosyl-L-methionine-dependent methyltran 
  49::100  4.6e-05 32.0% 0047303 00473031 1/1   nosyl-L-methionine-dependent methyltran 
   3::122  5.3e-05 28.6% 0050749 00507491 1/1   nosyl-L-methionine-dependent methyltran 
  33::186  9.8e-05 25.2% 0052618 00526181 1/1   nosyl-L-methionine-dependent methyltran 
  33::181  0.00013 26.1% 0042682 00426821 1/1   nosyl-L-methionine-dependent methyltran 
  47::119  0.00016 33.8% 0041593 00415931 1/1   nosyl-L-methionine-dependent methyltran 
  47::140  0.00019 32.6% 0050919 00509191 1/1   nosyl-L-methionine-dependent methyltran 
  47::100  0.00037 39.6% 0049778 00497781 1/1   nosyl-L-methionine-dependent methyltran 
  40::189  0.00042 27.5% 0041580 00415801 1/1   nosyl-L-methionine-dependent methyltran 
  37::186  0.00045 23.3% 0051840 00518401 1/1   nosyl-L-methionine-dependent methyltran 
   1::197  0.00052 25.4% 0051657 00516571 1/1   nosyl-L-methionine-dependent methyltran 
  47::192  0.00073 25.6% 0047862 00478621 1/1   nosyl-L-methionine-dependent methyltran 
   8::188    0.001 28.5% 0050693 00506931 1/1   nosyl-L-methionine-dependent methyltran 
   1::212


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKRKSHSARWLREHFRDSYVIQAKAQGYRSRAVFKLQEIDTRERLLGPGRVVIDLGAAPGGWSQWAAER
00465681   1/1  ---------------------------gyvsrgalklqelleklgllkpgervLDlGcGpGgltlvlaer
00479451   1/1  etlgellklrlnklikeefdlgnkfsklwldrsvydsyyfeakllglyrsraalkleelleklgl.kpgk
00488051   1/1  ------vnvlkidseevleallkegrellltpglvpgksvygedygdplgeearlwdprrsrlaaklali
00505191   1/1  -------------------------------lHipvlleellellapkpggrvlDlgcGtGghslalaer
00379821   1/1  ---melveklkedgvivvedvldafrlvsknlflgervygegvvkpqdegatiwaphrsrlaaklaeile
00484381   1/1  -seildglvivgkydlskdlfeeflgdydlvlafldglrsraerllelllellg.lkpgkrvLDlGcGtG
00520011   1/1  ---llletliellldlgrdllldervddylrdlikglpeallaledfadllykyaylfswrgrliiklpe
00467441   1/1  -------------ikrlvvllvlkglllsrlladalilvprhydlgedlygeelakvyddlaafldglrs
00499151   1/1  ------------------------------------------------Llvlgllielltpglrlllkvd
00466961   1/1  --dlsndlyelyldlydlyssaydllgdrpltda.....lleallellglkpgkrvLDlGcGtGglalal
00473861   1/1  ---------melfdevaeryddfadglspgqdrllel.llellaellkpgkrvLDiGcGtGglalalakl
00528071   1/1  --------------fdsyayfydalnllqlrprtealleal...lellglkpgkrvLDlGcGtGglalal
00473291   1/1  ------------vkllkegdrvllelgrplmllellregglldtrlgiepledllgvprglfldlavgyl
00490741   1/1  ---ledllrayllllpellllleslenladhldlgnppfelllgeeffeyfakvyelydafndglrpatr
00512611   1/1  ----------------------------------------------lkpgdrvLDiGcGsGgltlalarl
00401961   1/1  Mskkdlkeavaeyydlfadfydllldpnfhysygyfsgefldleeaqerlldlllellg.lkpgkrvLDv
00468401   1/1  --lslapllllllddvlleawlslldallegrldllellyglglfeylaldaevydafldglrpatelll
00469311   1/1  ----------erlfdeyaefyd.langlglrprqeallelllellp.lkpgkrvLDlGcGtGglalalak
00463541   1/1  ----------------renlvdnlaehydllnevleallkvprelflpevplrelayedeflpitlevge
00474711   1/1  ------------------------------------------------ldgwfteilwpglrlllkldel
00408291   1/1  -------------------vlipfehqevlleellellk.......lkpgkrvLDlGcGtGglalalakl
00484901   1/1  -----------------------------------------------lllldkllkllkpgdlvllllan
00519441   1/1  ------------------------------------------------slprwlvinllkllgeelleal
00491221   1/1  -mstvplselskklaeeffydlaadfydllldglfpsqrelldlllellglkpgkrvLDlGcGtGglala
00468381   1/1  ------edsllplllllldpllleallslleallegkydllellfgkelfeylagdaelydlfndglrpg
00518841   1/1  ----------------------------------------------lkpGdrVLDiGtGsGgltlllarl
00479191   1/1  ------Ydlgndlyellldedyfysdayyddpgdllrpaqerllelllellg.lkpgkrvLDiGcGtGgl
00518231   1/1  ---------idcallaerlnkalellkdllkklevlrlilregdglpglavdrygdwlvvlllealgeee
00502341   1/1  --------------------------------al.klelllellg.lkpgkrvLDiGcGtGglalalakr
00475801   1/1  --------medleearkklvelllrnngilnlrvldalervprehfvpsllgylafldlplafgegvlis
00518851   1/1  ------------------------------------------------eldgqlldlllklikeklkknl
00479231   1/1  -------------efydd..yalsfdeglrptqeellelllellgl.kpgkrvLDlGcGtGglalalakl
00474651   1/1  -------leddllplliryslpdwlvellldllgeeleallealllplpldlrvntlkisleellellek
00430851   1/1  ----msetetdfglarlklieeliashydlsvdvlealldvpreyfvlepayedlalafgtgvhilrpel
00403271   1/1  ---elafgkdffeylakdpdlalrflggmralsellldellealpdlsggkrvLDvGcGtGalllalakk
00495321   1/1  -----------------------------------------tigellrealalleeagldlldaelllll
00509881   1/1  ------------------------------------------------kalldillwliellslglalsl
00494741   1/1  ----------------------------------------------kngikdeilldyilsrprgeplde
00527091   1/1  --------qnhYDlsndfyelfldpsmtyssgyfedpgesleeaqeakldllldklg.lkpgkrvLDiGC
00498851   1/1  -------------------------------------------akllkpgdrVLDlGcGtGtlaialakl
00511031   1/1  kllelldldidllklsllklkkinklyknlknlilkntsnvskeeiakfydlvadffdevaayydglfgd
00496711   1/1  ----------------------------------------------nsvsglfdsiashydllndlyell
00390931   1/1  ----------------------------------------------eeffelfrdigkkydgwyfeepll
00514491   1/1  ---------------------------GadeyfefgpryiqepllelllelldlllkpgkrvLDiGcGtG
00497191   1/1  ------llllralllllelvelllelleklldsllkgeipfeyllgedffeyfdddaelydgfndglsga
00446891   1/1  Mveklirkhyildeevleaflkvprelfvpeplyslayfdglealkflgqnflsapellalllelld.lk
00511431   1/1  ----------------------------------qrellelllellg.lkpgkrvLDiGcGtGglalala
00478511   1/1  ------------------------------------------------klkksfdnvakhYdlgndlysl
00476761   1/1  ------------------------------------------------lldllsllllelglvlsdeqle
00519301   1/1  -----------------------------------------------vllslfaerlvealkllkklllk
00501541   1/1  -----------dvaeyfdd.iaavydgfaeglreaaea.llelllellppgkrvLDiGcGtGglalalak
00526491   1/1  -----------------------------------------------ddlyddglsliqrellelllell
00507451   1/1  ------------------------------------------------llvlllllllalnkalkllrdl
00502421   1/1  ----------------------------------------------dvkdfydelaelyddlldelsdal
00491711   1/1  -------skyywdefyrp....................lldallellglkpgkrvLDlGCGtGglllala
00450601   1/1  Mssteklsplliehkelveefyd......slaerydelrgvllrpaqrallelllellgllpgkrvLDvG
00494421   1/1  ----------------------------------------------lkpgerVLDlgcGtGgltlalakl
00472111   1/1  ----------------------------------------------nsdmsddefdpkkyldefyddyag
00507621   1/1  -----------veehyde..laefydkllgelliprpateellelllellg.lkpgkrvLDlGCGtGrla
00421971   1/1  Msdcplcpesltpsellykeevarvfdriaerydrlrpvpsplyyllgddeeayldlllfpgagiprpla
00528941   1/1  --------------ylgdydklrllrsnlaeqllslla........lrrglrilDlGcGtGalllalaev
00518421   1/1  Mkek.......vkeyydelaerydllrgslplrpaaealldlllellppggrvLDlGcGtGrlalalaer
00521821   1/1  --------------diteeelleyvlrhsfvpdpllllalrdealdvggglpilspekgalllellrllp
00413261   1/1  rskrvpleyilgeadfyglpldvggafltprpitellleallel.gllkgkrvLDlGcGtGilaialakl
00530771   1/1  ------------keyydeiaerydpaqrallelllellg.......llpggrvLDlGCGtGrlalalarr
00414441   1/1  ---------tysagyydlpad......ilrpateelldlllellg.lkpgdrvLDlGcGtGglalalara
00350261   1/1  ----------nvTsffrdpehfdalaelllpll...............pglrvLdlGcGtGeepyslaml
00486291   1/1  ---------------sydniaihydmlndrprtealleallellg.llkgkrVLDvGcGtGilslalaka
00516171   1/1  --------------------------------QnfltdpalldailellglkpgdrVLDiGcGtGaltla
00509351   1/1  ---nmllelllklllllglnlseeqyekledyfdllldwnkkynllsskdpdrlwerhildsllllelld
00516791   1/1  -----vlgnddyqeefdpealadefyalaseydpldrllllllerllellslglkpggrvLDvGcGtGll
00491861   1/1  ------------------dklvtallvlaarakesarpdgylpslklDpyaaylvdriaaealrlllgld
00409641   1/1  ----------wfterltpekafslkveevlyeakseyqqiflvdsevfgkllfldgvlqsterlefpyhe
00445501   1/1  ----------------------------------------------lkpgdrvLDlGCGtGgltlalAkl
00530871   1/1  ------------------------------------------------pggrvlDpgcGsGgfllalaer
00473031   1/1  ------------------------------------------------prellkeflkakkslgqnfltd
00507491   1/1  --egeplriilgkleglklkldpgqafltprpvtellvdallel.gllkgkrvlDlGaGtGalslalakr
00526181   1/1  --------------------------------lqeitedllellfnallllienlldgaldalleilpel
00426821   1/1  --------------------------------qnfltdpeilekilelldlkegdrvLdiGcGtGaltle
00415931   1/1  ----------------------------------------------lkpgdvvlDiGcGtGglalalAkl
00509191   1/1  ----------------------------------------------lrpggrVLDvGcGtGglalalaea
00497781   1/1  ----------------------------------------------lkpgdtvlDlGcGtGnlaiqaAle
00415801   1/1  ---------------------------------------mekkelldwiaelldlgldlykleaelllde
00518401   1/1  ------------------------------------qvmlklikkqikeypqdklvripekaslyllvle
00516571   1/1  pedevkelirsfydraadrydgqnrlleelgdgvmlaqerallrllallglrpggrvLdvGcGtGllala
00478621   1/1  ----------------------------------------------lnpgekvLdvGcGsGlllallaea
00506931   1/1  -------llriiggkfrgrkllvpp..gprptterlrealfnllllllleggrvLDlgaGsGalaleaas


                         -         -         *         -         -         -         -:140
query           VGERGRVIAMDILPMLSCPGVQFIQGDFREDNVLAELQNTLAGCVVDLVMSDMAPNMSGMAAVDQPRAIY
00465681   1/1  vgpggrvvavDlspmlelarvefiqgdardlplldlllellpdgsfDlvlsdaplshlgdlrrdlarlaa
00479451   1/1  rvLDlGCGtGglalylakrypg.akvtgvDispemlelarenkrlgldnvefiqgvda..........lp
00488051   1/1  lellg.lkpGdrVLDlGcGsGgltlhlaelvgpeGkVygvDispemlelarenleelgnvefilgDaeel
00505191   1/1  g...grvigvDidpealalarerlaglgllnrvefvqgdalalp........lpdgsfDgvlldlglssl
00379821   1/1  lld.lkpGdrVLDlGcGtGgltlhlaklvgpeGkvvgvDispemlelarenleklgnvefilgDaee...
00484381   1/1  glalalakllga.grvtgvDispealelarenakrlgnvefivgDaedl.....ldlplpdgsfDlvvsd
00520011   1/1  dgallrlllaelkpkriLElGcgtGgsllllaealkllgpdgkvvgiDispemlevarglldnvtliqgd
00467441   1/1  rqeallelllellg.lkpgkrvLDlGcGtGglalalakllga.grvtgvDispealelarenaaglpnve
00499151   1/1  elllserskyqeirvyelgddgrvllldgllqgsslderqrallllllallglkpgkrvLDiGcGtGgla
00466961   1/1  akr.gak.rvtgvDisp.mlelarenaaenglpnrvefivgDaedl........plpdgsfDlvvsnpsg
00473861   1/1  lgepgarvtgvDispemlelareraaelglsdnvefvvgDaedlp.lpd.........fDlvvsnavlhh
00528071   1/1  akr.gak.rvtgvDisp.mlelarenaaenglpnrvefivgDaedl........plpdgsfDlvvsnplp
00473291   1/1  vlilrpltedlveafgrgtqitqpavaalllellglkpGarVLDlGcGtGaltlalaravgpggrvvavD
00490741   1/1  lllelllell.glkpgkrvLDiGcGtGglalalakalPga.rvtgvDipemlelarenaaelglspnvef
00512611   1/1  vgpegrvtavDiseealelarenlerlglddnveviqgDaed..plpd.......gsfDaivsdl.pdpw
00401961   1/1  GCGtGglllalakryg..arvtGiDispemlelareraaelglpnrvefvqgdaed...lp.......d.
00468401   1/1  dlllellg.lkpgkprvLDiGcGtGglalalakrlPga.rvtgvDipemlelarerpnvefvvgDaed..
00469311   1/1  .lgpk.rvtgvDisp.mlelarenaaenglpnrvefivgDaedlleplpd.........fDlvvsnPpgg
00463541   1/1  gllisqpetlalllellglkpgkrvLDiGcGtGylalalarlggpdgrvvavDispealelarenaerlg
00474711   1/1  lheekskyqiiriydlgndgrvllldglvlgsrpdeaqerllllllallplkpgkrvLDiGcGtGglala
00408291   1/1  lpg.arvigvDispealelarenlkelg.dnvefiqgdald...lpellllfpdgsfDlilsDp.Pyssl
00484901   1/1  nlllpltlrvnklkltrfgllnvlelsgknavahydlsndvyellldpaysdslarfgegntllqpelae
00519441   1/1  leallellplvlrvnellaelgielerdelgppllyllggvefadlplyktgvfitqdeasallaelldl
00491221   1/1  lakr.ga..rvtgvDispemlelarenaaelglsdaddnvefivgDaedlplpellle...dgsfDlvvs
00468381   1/1  serlldlllellpllkpgkrvLDiGcGtGglalalakal.PgarvtgvDipemlelarerpnvefvvgDa
00518841   1/1  vgpkGrVigvdiseemlelarenlkrlgldlhleklgyaldnvefilgdaeell......kllpdgsfDa
00479191   1/1  alalakalg..arvtgvDispemlelareraaelglpnrvefvvgDaedl...........dgsfDlvvs
00518231   1/1  leelleallellpelrvnllkisredlleelldelielllgerdllgelyenglrflvdp.dgfgtglfp
00502341   1/1  g...arvtgvDispemlelareraaelglpnvefvvgDaedlp........fpdgsfDlvvsnavlhhlp
00475801   1/1  qpellalllelldlkpgdrvLDiGcGtGylalalaklvg..grvtavdispealelarenaerlgldnve
00518851   1/1  glnldllplgegqyieelwpglalslkvdevlhekkskyqiiriydlgndgrrlfldggvqysrlderql
00479231   1/1  gp...kvtgvDispealelarenakelglddnvefivgDaedlp........lpdgsfDlivsdpplhhl
00474651   1/1  lgvvleaydllgdpleyllglrefyslplfkdglvltqdavsellvelldpkpgdrVLDlGcGsGglala
00430851   1/1  lalllellledlkpgarVLDiGcGsGyltlalarlvpelgkdpggrvvgvDispealelarenlerlgld
00403271   1/1  yPga.kvtgvDlspmlelarenprvefvvgDafd..plp.........sfDlivsswvlhhlpdee....
00495321   1/1  llgldrlrlllllllplsvlelllllellerrllgepveyllgerefyglafkvgggvftprpttellle
00509881   1/1  kidklleeekskyqiiriydlgnfgyelfldgrllysrldeaqytelllllllldlkpgkrvLDiGcGtG
00494741   1/1  lldeyedyalkfglglliiqpellalllelldlkpgkrvLDiGcGtGglalalakllppgakvtgvDisp
00527091   1/1  GtGglarylaeryg..arvtGiDlseemlerareraaeaglsnrvefivgdaed...lp........gsf
00498851   1/1  .ga..rvtgvDispealelArenaarngldnvefvqgdaed...lp.......dgsfDlvvsnppl....
00511031   1/1  llslrpaqeellelllellp.lkpgkrvLDiGcGtGglalalakrlga..rvtgvDispemlelarenaa
00496711   1/1  ldedyfysygyfddyglglrpaqeallelllellglkpgkrvLDiGcGtGglalalakalg.a.rvtgvD
00390931   1/1  pglalsykvdrvlhegkspyqeililespdfgrllvldgvvqlserleliyhealahllllllkppkrvL
00514491   1/1  glalalakllpg.akvtgvDispemlelarenakelglpnvefivgdaed......lpellpdgsfDliv
00497191   1/1  qelllelllellp.lkpgkrvLDiGcGtGglalalakal.pgakvtgvDipemlelarenakelglpnrv
00446891   1/1  pgkrVLDiGcGtGyltlllaklgg...kvtgvDiseemlelarenlkeng.....nvefivgDaeel...
00511431   1/1  krgp...rvtgvDispemlelareraaelglpnvefvvgDaedlp........fpdgsfDlvvsnavlhh
00478511   1/1  ildpdmfysygyyddpdetlrpaqelllelllellglkpgkrvLDiGCGtGllalalakrvga..rvtgv
00476761   1/1  klealldllldwnpvinltgsrefdelwlrvlldllallplkpgkrvLDlGcGtGllalalakllp.gar
00519301   1/1  glvnayrlvlgegdllrglavdrypdwlvvlllsalgeeelealleallellpdlrvnllkisreeklll
00501541   1/1  r...garvtgvDispemlelareraaelgl.nvefvvgDaedlp........fpdgsfDlvvsnavlhhl
00526491   1/1  dlllkpgkrvLDiGcGtGglalalakllpg.akvtgvDispemlelarenakelglpnvefivgDaed..
00507451   1/1  lrklglpayrlvlgegdllrglavdrygdwlvvlllselgleelealleallellppidlrvnklkisre
00502421   1/1  ldlllellglkpgkrvLDiGcGtGglalal.......grvtgvDispemlelarer....nvefvvgdae
00491711   1/1  rl.ga.gevtGvDiseemlelArerakeaglsdnvefivgdaed...lpe....fpdgsfDlvvsnfvlh
00450601   1/1  CGtGllslalaer.ga..eVtgvDiseemlelAreraaengldpgadnvefvvgdaed...lpell..fp
00494421   1/1  vgaag.vvavDispealelarenaelngl.nvefivgDale......llkllpdgkfDlillDPPysgsg
00472111   1/1  rffrlreilrllldellallgllpggrvLDvGcGtGllalalaralppgarvtg----------------
00507621   1/1  lalakr.gp..evtgvDispemlelArerakengl.nvefiqgDaed...lpf.dgsfDlvvsnpnvlhh
00421971   1/1  elllelldel.....llkpgkrvLDiGCGtGylalalakl.lPgarvtgvDispemlelArera.....g
00528941   1/1  lppdvrvvgvDiseealekarqrlganpl.niefivgdalqlp........l------------------
00518421   1/1  .ga..evtgvDispemlevarergnvefvvgdaed...lp.....fpdgsfDlvvssfgvlhhlpdp...
00521821   1/1  gkrvLdiGtGtGysalalaralppgarvvavdispealalarenleaaGledrvtvilgdaedl..lpql
00413261   1/1  .Ga.akvtavDispealelarena.....gnvefivgdaee...lp.......g.kfDlivsNPPyvpls
00530771   1/1  .ga..rvtgvDlspemlelareraaaagldnvefvvgdaed...lpf.dgsfDlvvsngvlhhlppedle
00414441   1/1  vg..arvtgvDispemlelareraeelglp----------------------------------------
00350261   1/1  llealalagpgarvtatDispealekareglyplgllrglplellkryflkllgadgglyrvkpelrdrv
00486291   1/1  .Gak.kVtgvDispmlelarenaklngldnrvefiqgdaedl........plpd----------------
00516171   1/1  lakr.ga..rvtgvDispemlelareraaengladnvefiqgDaedl.......----------------
00509351   1/1  ...................lkpgkrvLDlGcGtGllaialaklfp.gakvtgvDispemlefarenakkl
00516791   1/1  alllaarlga..rvtglDlspamleearkrlaelgladdwsplvkvvcelegklllleeleellrdlvnv
00491861   1/1  lflrllagellklldrdfpginrgyaaRtrfiddlvrrflae.gpraqvld-------------------
00409641   1/1  alahllllnlkkgkrVLdiGcGtGglarellkh..gaaevtgvdidpevielakenlklnglsvlnagal
00445501   1/1  ga...rVvgvDispealelarenaklngldnvefivgDaee..llkel..pfpdgsfDvvvsDPPysgls
00530871   1/1  llpgarvvgvDidpealelaren...eivvgDalell...p.desfDliiaNPPyggsgdldrlldellk
00473031   1/1  pnladkivelldllpgdlnleglrvLeiGc----------------------------------------
00507491   1/1  .ga.kkvvavDidpealelarenaelngl.nveviqgdale...lp......------------------
00526181   1/1  lgllflldlllddellrelldllseidlseidydilgelyeyllgefaglrfklgefytprpvtellvel
00426821   1/1  lakrgg...kvtaieideemlelakenlkelgnvefiqgDalklp........fpdgkfDlivsNpPyni
00415931   1/1  tg.akhvyGieiseealelakenakenkkrlklfglgidnvefiqgdae---------------------
00509191   1/1  gpe..evtgvDispemlerareraaelgpnvrvlvgdae......ellpplpdgsfDavlsDppgssevl
00497781   1/1  yGak.kvvGidispeaielakenlkelgkl----------------------------------------
00415801   1/1  vlgldraglllgdrgltleelakflelierrlegepleyllglyeflglefgtgpgvfiprpttelllel
00518401   1/1  alltglnllqrllaafllelldlfkgkrvLdiGaGtGllllalaellppgaevtgiDidpdalevarknl
00516571   1/1  laeagp..aevtgvDispemlerareraaeag.pnvrvlvgdae......dllpplpdgsfDavlsDpps
00478621   1/1  igvagkvlgvDidaevldlaednlkknglsllssgnvelvvgdllkli..le.dgkfDvvlsdppl....
00506931   1/1  rga...evvavDidpeavalarenaerlglenrveviqgdaf......ellaalpgesfDlvvldPPy..


                         +         -         -         -         -         *         -:210
query           LGELALAFAQESLGPEGSFLLKTFQGEGFDALYEVIRQDFSRVRIHKPPASRGRSREVYIVARRSRKDNG
00465681   1/1  lqlalleealrlLkpgGrlvlstcseeneevllallkkyfdlvllvkpiasrdgnsefylvalgfkg---
00479451   1/1  fpdgkfDlvvsDppfsgvlhhvpdpellel.....lkeaarvLkpGGrlvlstftlfeeeneellei---
00488051   1/1  lkl.....pfpdgsfDvvlsdavlh.......pdp......eaaleealrvLkpGGrlvisdf-------
00505191   1/1  gldradndeledlae.aleeaarvLkpGGrlvvitfhsledrivkrfflelffklltrkpilpsee----
00379821   1/1  ...lpkyllpdgsfDvilsdapl.............shlpdealeealrvLkpGGrlvisdfsrsi----
00484381   1/1  .lphlpdp............eallreaarlLkpGGrlvlstpsreeeellellllleellelleegfelv
00520011   1/1  aldlpflekllel..g.sfDl-------------------------------------------------
00467441   1/1  fivgDaedp.....lpdlleegsfDlvvsd.lphvpdp............ealleeaarlLkpGG-----
00499151   1/1  lalakr.pegarvtgvDispealelarenlaelglgllddpnvefivgDaedflpfl........dg---
00466961   1/1  vlhhlpd..............eleallrelarvLkPGGrlvlstps------------------------
00473861   1/1  lpdpdl.........eallrelarvLkpGGrlvlsepnlpdleellel----------------------
00528071   1/1  fvlhhlp.........dleallreaarvLkPGGrlvlstpsppgleell---------------------
00473291   1/1  ispealelarenlaraglalpdnvevvvgDaedlp........lpdgsfDavvsdl.pdp----------
00490741   1/1  vvgDaed.........plpd.sfDlvvsngvlhhlpdpdlea...............ll-----------
00512611   1/1  ...............elleelarlLkpGGrlvlstptieqleellelleeaGfevveveellpryartle
00401961   1/1  sfDlvvsnevlhhlgpedlea.........alkelarvLkpGGrlvlstinledleelrealef------
00468401   1/1  plp.........sfDlvvsngvlhhlpdpel..............eallrelarvLkpGg----------
00469311   1/1  vlhhlpd............leallrelarvLkPGGrlvlstpnrpg------------------------
00463541   1/1  ldnvefilgdaedllfe........dgsfDlvvsdapl--------------------------------
00474711   1/1  lakrgp.darvtgvDispealelarenlalnglelglpnvefivgDaedflpfl.......---------
00408291   1/1  gllifvlhhledleefleealrvLkpgGrlvlvtfssledeivkkllkelgklvlvvkgpllpslee---
00484901   1/1  lllelldlkpgkrvLDiGcGtGglalalakllgpdarvtgvDispea-----------------------
00519441   1/1  kpgdrVLDlgaGsGgltlalael-----------------------------------------------
00491221   1/1  nfav.lhhlptgrrdpedlea.......llrelarvLkPGGrlvlstp----------------------
00468381   1/1  ed..plp.........sfDlvvsngvlhhlpdpe..............leallrelarvLkPGG------
00518841   1/1  vfldl.pd...............peealeellrvLkpGGrlvifvptieqverlle--------------
00479191   1/1  navlhhlpledlea.........llrelarvLkPGGrlvlstpnrdgleellellllll-----------
00518231   1/1  tqellaelllelldpgkrvLDlGcGtGglalala.klga.grvtgvDispe-------------------
00502341   1/1  dpe.................allrelarvLkPGGrlvlstpnlp.dlellrlllalllrl----------
00475801   1/1  vilgdaeell........fedgsfDlvvsdapl.................ph------------------
00518851   1/1  eelllllalldlkpgkrvLDlGcGtGglalalakrgp.darvtgvDispealelarenlaenglaldd--
00479231   1/1  pd..............llkellrlLkpGGrlvlstpnpegleellellkklgflvelillyifpyvp---
00474651   1/1  laklvgpagrvvavDispealel-----------------------------------------------
00430851   1/1  lllpdnvefivgdaedlp........fpdgsfDlvvsnavlhhl........------------------
00403271   1/1  ......lvkllkeayraLkpgGrliivepvlpdlgelpltellallldllmlvltdggre----------
00495321   1/1  lllellpkpgkrvLDlGcGtGglalalakllpga.rvtgvDispealelarenaalng------------
00509881   1/1  glalalakrgp.aakvtgvDispealelarenlkelglslddpnvefivgDaedllkpl........---
00494741   1/1  ealelarenakenglpnrvefivgdaedf..lpfllaegl------------------------------
00527091   1/1  Dlvvsievlehvgpedl.........eaflkelarvLkpgGrlvlsdpnrpdlleleelllllp------
00498851   1/1  .........ehlpd.llaeaarlLkpGGrlvlveinpetleellelleeaGfevveveel....------
00511031   1/1  elgl..vefivgDaedlp........fpdgsfDlvvsngvlhhlpdpelk.........kllke------
00496711   1/1  ispemlelarenaaelglpnrvefvvgDaedl...........dgsfDlvvsnavlh-------------
00390931   1/1  diGgGtGglarellkh.gpvakvtgvdidpevielarenfklnglald----------------------
00514491   1/1  snpPypsgvlhhlpdpl...lqeellkelarvLkpGGrlvlstpnld-----------------------
00497191   1/1  efivgDaed.........plpdg.fDlivssgvlhhlpdpel..............e-------------
00446891   1/1  .....pfpdesfDlivsnaplhhl.................leellrlLkpgGrlvlvdg----------
00511431   1/1  lpdp...............eallrelarvLkPGGrlvlstpnrpdl------------------------
00478511   1/1  Dispemlelarenakenglpnrvefivgdaedl...........dgsfDlvvsn----------------
00476761   1/1  vtgvDispealelarenaaelgldnvefvvgdaedlp.p........dgsfDlvvsnppy.......---
00519301   1/1  rreeilpllpetlleeflglrfkvdpgvffqtglfptqelllelllellk--------------------
00501541   1/1  pded...........leallrela----------------------------------------------
00526491   1/1  lpellpdgsfDlivsnpPypwpgvlhhlpd..............ellekll-------------------
00507451   1/1  elgepvelllgelpeelyvqflglkfkvdpgvffrpgtellvelllelldl-------------------
00502421   1/1  dlp........fpdgsfDlvvssavlhhl.....pdpea......llrelarvLkPG-------------
00491711   1/1  hlflspedl...........eaalreiarvLkPGGrlvlstpnpddllellellrflerlylll------
00450601   1/1  dgsfDlvvsnfgvlhhlPpyf.........ldpedleaalrelarvLkpGGrlvlstpnredla------
00494421   1/1  tlrrvpdieprlalkglldllel-----------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00507621   1/1  lppedl..............ekllrelarvLkPGGrlvlstpnpegleellalllallllelvllvd---
00421971   1/1  nvefivgdaed...lp.fpdgsfDlvvssfvlhhl.d..........-----------------------
00528941   1/1  ----------------------------------------------------------------------
00518421   1/1  ............eaalrelarvLkPGGrlvlstpnreslpelrelllaylllkllfpelgyrll------
00521821   1/1  laplpdgkfDlifldapl............ehlpdlle--------------------------------
00413261   1/1  dilllevldleplsallehldd......leelleeaarlLkpgGrlvls---------------------
00530771   1/1  ..............allaelarvLkpGGrlllstpnrldlrkglppplrllsleellelleeaG------
00414441   1/1  ----------------------------------------------------------------------
00350261   1/1  eflqgdlldlppp..ldgsfDlifcrnvliyfdd.............-----------------------
00486291   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00509351   1/1  gldnvefiqgdaedlpfelll...----------------------------------------------
00516791   1/1  elvvgdaedlplpdellgsfDlvvssfvlehvceglddlra............alaelarvLkPGG----
00491861   1/1  ----------------------------------------------------------------------
00409641   1/1  ddprvevivgDalellfe........dekfDviiaDlpdsiglphlldlee.......flrelyr-----
00445501   1/1  gvlhhlpdpelkrivyvscnpellaelarlLkpGG-----------------------------------
00530871   1/1  rlydelalalsgvlglldlyrafleealrlLkpgGrlvfvtpnsflfsegeeklrefllenglllaiid-
00473031   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00526181   1/1  llpklgdl.kglrvLDpgCGsGgllialakrlpnaggaevtllGvD------------------------
00426821   1/1  ssavlhhl....edlekarrltlmlqleealrlLkpgGrlv-----------------------------
00415931   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00497781   1/1  ----------------------------------------------------------------------
00415801   1/1  llellglkpgkrvLDlGcGsGllaialak.lga.akvtgvDispealel---------------------
00518401   1/1  krlglpkrvrlvvgdalda..lpalaegvedgkfDliildfvlehl------------------------
00516571   1/1  evlhhvrrpdp......eaflreaarvLkPGGvlvlstlllagl.....elerdaeh-------------
00478621   1/1  ..................ehileeiarlLkPGGklvlvtpdinqleelkkll------------------
00506931   1/1  .........gldglellllllaarllkpggllvlehglelllp.llll----------------------


                         -         -         -         +         -         -         -:280
query           GG--------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00512611   1/1  t---------------------------------------------------------------------
00401961   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00474651   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00502421   1/1  ----------------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00450601   1/1  ----------------------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00528941   1/1  ----------------------------------------------------------------------
00518421   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00491861   1/1  ----------------------------------------------------------------------
00409641   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00415931   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00497781   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00478621   1/1  ----------------------------------------------------------------------
00506931   1/1  ----------------------------------------------------------------------