[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA59402.1


[Show Plain Result]

## Summary of Sequence Search
   1::337
  20::336  7.8e-80 37.5% 0044760 00447601 1/1   inked oxidoreductases                   
   9::257  2.4e-60 35.3% 0047140 00471401 1/1   inked oxidoreductases                   
  22::282    1e-51 31.0% 0051899 00518991 1/1   inked oxidoreductases                   
   9::255  5.4e-49 29.7% 0046599 00465991 1/1   inked oxidoreductases                   
  11::262  3.2e-44 24.8% 0042445 00424451 1/1   inked oxidoreductases                   
  21::283  3.9e-42 24.0% 0038429 00384291 1/1   inked oxidoreductases                   
   6::275  7.2e-42 26.7% 0049708 00497081 1/1   inked oxidoreductases                   
  21::285  7.7e-41 28.3% 0052481 00524811 1/1   inked oxidoreductases                   
   6::259  1.9e-38 26.3% 0046721 00467211 1/1   inked oxidoreductases                   
  14::271    3e-34 26.4% 0039781 00397811 1/1   ose-phoshate binding barrel             
  70::257  9.3e-32 32.4% 0052610 00526101 1/1   inked oxidoreductases                   
   9::273  1.4e-31 23.6% 0051489 00514891 1/1   inked oxidoreductases                   
   9::302  9.1e-28 22.9% 0038308 00383081 1/1   inked oxidoreductases                   
  20::257  1.6e-24 22.8% 0050322 00503221 1/1   ose-phoshate binding barrel             
   8::259  1.7e-23 23.4% 0036258 00362581 1/1   inked oxidoreductases                   
  73::255  9.4e-22 28.1% 0039992 00399921 1/1   ose-phoshate binding barrel             
  79::257    2e-21 34.4% 0051598 00515981 1/1   ose-phoshate binding barrel             
  11::261  9.2e-21 23.3% 0036457 00364571 1/1   inked oxidoreductases                   
  35::249  1.5e-20 25.4% 0039482 00394821 1/1   ase                                     
  64::271  1.7e-18 22.0% 0049629 00496291 1/1   ose-phoshate binding barrel             
  38::258  5.3e-17 25.4% 0041658 00416581 1/1   ase                                     
  73::255  7.2e-16 23.4% 0051442 00514421 1/1   ose-phoshate binding barrel             
  67::254  1.9e-15 27.7% 0048029 00480291 1/1   inked oxidoreductases                   
   8::294  4.9e-14 24.7% 0047026 00470261 1/1   inked oxidoreductases                   
  11::273  9.6e-14 19.0% 0049661 00496611 1/1   ase                                     
  63::257  3.7e-13 27.4% 0050003 00500031 1/1   inked oxidoreductases                   
  39::255  7.8e-13 23.5% 0047125 00471251 1/1   ose-phoshate binding barrel             
  23::244  3.1e-12 22.6% 0049848 00498481 1/1   ase                                     
  68::259  3.2e-12 24.7% 0051164 00511641 1/1   ose-phoshate binding barrel             
  70::247  8.1e-12 26.5% 0050135 00501351 1/1   inked oxidoreductases                   
  86::295  1.2e-11 22.3% 0048661 00486611 1/1   inked oxidoreductases                   
  70::256  1.5e-10 21.8% 0036628 00366281 1/1   ose-phoshate binding barrel             
 100::255    5e-10 22.9% 0048998 00489981 1/1   ose-phoshate binding barrel             
  21::263  6.2e-10 19.1% 0041152 00411521 1/1   ase                                     
  70::330  1.6e-09 23.9% 0047651 00476511 1/1   se C-terminal domain-like               
  49::257  6.2e-09 24.3% 0045712 00457121 1/1   ose-phoshate binding barrel             
   9::248  6.7e-09 23.9% 0047242 00472421 1/1   inked oxidoreductases                   
  70::257  6.5e-08 23.3% 0045046 00450461 1/1   in phosphate synthase                   
   9::259    1e-07 23.0% 0042611 00426111 1/1   inked oxidoreductases                   
 132::260  1.2e-07 20.0% 0048768 00487681 1/1   ose-phoshate binding barrel             
   4::272  1.4e-07 22.2% 0044803 00448031 1/1   inked oxidoreductases                   
 202::262  7.2e-06 26.7% 0050201 00502011 1/1   inked oxidoreductases                   
  92::261  1.3e-05 27.9% 0049739 00497391 1/1   like                                    
   9::247  1.5e-05 24.7% 0049587 00495871 1/1   inked oxidoreductases                   
  93::305  6.2e-05 19.2% 0041693 00416931 1/1   ase                                     
   1::286  0.00022 21.5% 0038972 00389721 1/1   inked oxidoreductases                   
  69::338  0.00037 21.8% 0048445 00484451 1/1   se C-terminal domain-like               
 112::247  0.00041 22.8% 0044928 00449281 1/1   ephosphate isomerase (TIM)              
 202::269  0.00068 28.4% 0049146 00491461 1/1   ose-phoshate binding barrel             
   1::337


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLFSYDCKKTIQMADYSKAYKISVAPMMEWTDRHCRYFLRLISHRALLYTEMVTAGALIHGNRARFLAYH
00447601   1/1  -------------------nrlvlAPMvgvtdlpfrlllarl.gaglvytemvtakdllrgglkrlllav
00471401   1/1  --------LstellgltlknPlvlApmadvtdlelrraaar.ggaglvvtemvtaeqpqegnpkprlfrl
00518991   1/1  ---------------------DlstellglklknPiglApmgvskdaeaiaalaagglGiielgtvtlap
00465991   1/1  --------pkdvpllstlilglklknPiilApmadvtdaelaaalalaggggvlgktmtpepqagnpvpr
00424451   1/1  ----------kmsrLfeplklggltlknRivmaPmtryladdgvptdlllayyaqrakggagliiteata
00384291   1/1  --------------------kmskLfePlklggltLknRvvmaPmtrylatlddgvptdlalryyaqra.
00497081   1/1  -----lnlldlralalrrllrpllfyldgetahrltlaflrigllprvlvvsdvdlstellglklknPfg
00524811   1/1  --------------------lLsttllglklknPlglaaglvdkdaeailalaalgfgiielgtvtlapm
00467211   1/1  -----alrrllrpllfylddevtlrlnllafddilllprvlpdvsldvdlsttllgltlknPlvlapm.t
00397811   1/1  -------------gllglelpiriaPmldvtdglvvrllqgkygaalvykemvfsdllllgdpvelakay
00526101   1/1  ---------------------------------------------------------------------l
00514891   1/1  --------lslLfeplklggltlkNRivmaPmtrylaldedgvptdlllayyaqrAkggaGliiteatav
00383081   1/1  --------lslkmskLfePlklggltlknRivmaPmtryraedgvptdlllryyaqra.gagliiteata
00503221   1/1  -------------------lamriiPalDlkdgrvvrlvqgdldnlrvvgd.......pvelaavylegg
00362581   1/1  -------merlaelmlpkrlipyllvgldrevthrlnlkaldrvalipevtagdpdlsttilglelknPl
00399921   1/1  ----------------------------------------------------------------------
00515981   1/1  ----------------------------------------------------------------------
00364571   1/1  ----------letlslskLfePlklggltLknRivmaPmtryr.dgvptdllleyyalralggagliite
00394821   1/1  ----------------------------------leeklriaklllallidhtllgppatseeireliae
00496291   1/1  ---------------------------------------------------------------lelikei
00416581   1/1  -------------------------------------llldlltkalllllllllgrlllknillalsll
00514421   1/1  ----------------------------------------------------------------------
00480291   1/1  ------------------------------------------------------------------raka
00470261   1/1  -------esllnladlealarrrlpkrkfdyldggagdevtlrrnrlafddvllvprvlpdvsdvdlstt
00496611   1/1  ----------gkllrlerlsnrdgrllilAiDqrvslgpmlalkdgkavrlvsgledfktvvsealeaga
00500031   1/1  --------------------------------------------------------------rkelvrel
00471251   1/1  --------------------------------------lmlkriiPaldlkdgkvvlvkgvllvplvtag
00498481   1/1  ----------------------elaklidltllnplatlediealceeaiklgfaavcvnpvfvrlalel
00511641   1/1  -------------------------------------------------------------------dll
00501351   1/1  ---------------------------------------------------------------------l
00486611   1/1  ----------------------------------------------------------------------
00366281   1/1  ---------------------------------------------------------------------k
00489981   1/1  ----------------------------------------------------------------------
00411521   1/1  --------------------lldlanlidltllkpdltledieklidealeygfaavcvnplyvklakdl
00476511   1/1  ---------------------------------------------------------------------v
00457121   1/1  ------------------------------------------------llllstiLdkIvadkleevaal
00472421   1/1  --------dllnladlealakrrlpkrafdyldggagdevtlrrnrlafddvllvprvlvdvsdvdlstt
00450461   1/1  ---------------------------------------------------------------------i
00426111   1/1  --------kmskLfePlklggltlknRivmaPmtryraedgvptdllleyyaqrAkgggliiteatavsp
00487681   1/1  ----------------------------------------------------------------------
00448031   1/1  ---mskLfePlklggltlkNRivmaPmtrylaedgvptdllleyyaqrAkgggliiteatavspegrgyp
00502011   1/1  ----------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00495871   1/1  --------nllsladlealakrrlpkrkfdyldggagdevtlrenrlafddvllvprvlpdvsdvdlstt
00416931   1/1  ----------------------------------------------------------------------
00389721   1/1  llklskLfePlklggltlknRivmaPmtryraedgvptdllleyyaqrAkgggliiteatavspegrgyp
00484451   1/1  --------------------------------------------------------------------kv
00449281   1/1  ----------------------------------------------------------------------
00491461   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KSEHPLALQLGGSHPEELALCAQMAEDYGFDEVNLNVGCPSNRVQSGRFGACLMAEPELVAECVAAMAQA
00447601   1/1  deegrplvvqlagsdpedlaeaaklaee.gadgidlnfgcpvskvrrdgyGaallkdpelvleivkavre
00471401   1/1  pedevllvaevlglinrmglnnlglealleeiralkdaagdlpvivqlgvgsdpedlaeaarraeeaGad
00518991   1/1  qegvtdprvrrl.....gaglinleglnnrglealllelakaagikglplgvniggsgpeelaeaakllv
00465991   1/1  arrldeaginrlgfndlgaaaelrrllkllvksiaevpiivnlvgggireldaedarllleagadaveln
00424451   1/1  vspegrgypgtlglwsdeqieglkkltdavhaeggkifiqLahagrvasgllpvapsaipaplglvvpra
00384291   1/1  gagliiteatavspegrgypgtlgiwsdeqveglkkvtdavhaaggkialQLwhagrvaspsllpggllp
00497081   1/1  lapmgdknlelaralaal..gaglvvtgtvtpvpqegnpkprlfrlpedealinlyglnnegldallerl
00524811   1/1  agvtdprlrrl.....gagllnreglnndgleaalkllrralkagkpglpvgvnlggnrpedlaeaarll
00467211   1/1  vtdaelaialaalgagl.ivlgtvtveplegnvsprllrlpedeaiinlyglndpgleellervkaagik
00397811   1/1  eeaGadalhvldldaafaggvtrgvllelikeiaeavpipvqvgggirsledlaaaiivfleaaiillna
00526101   1/1  kkglivaltlgdpdkedlvelakaleeaGadaieldgsf..............gvtvenvlelvkavke.
00514891   1/1  splgrgypgvlglwsdeqieglkkltdavhaagaliaiqLwhaGrvallgllpvaPsaipldlllevpra
00383081   1/1  vspegrgypgtlgiwsdeqieglkkltdavhaeggkiflQLahaGrvaspalllgglppvaPSaipapll
00503221   1/1  adelhvvdldgalgpevlaeaieaiaeltdlpidvnggirsledaealleagadkviigtaalknpelva
00362581   1/1  vlapmag.gnaelaaalaa.gGagaievgtvtpdpqagnpvprlarlralagginrmglnnlgldallee
00399921   1/1  --mlakriipaldlkdgrvvrlivglnggdpedpveaakaaeeaGadaielndldpallgpeallevira
00515981   1/1  --------qgggidpedpaelaraaeeaGadaielndgcpfdsrlld..gsgllpdp....eiikavrka
00364571   1/1  atavspegrgttpgtpglwsdeqieglkklvdavhaagalifiqLwhaGrvaspsllgllpvapsaiplp
00394821   1/1  aaklvkgfaavcvypgdvglaaellkgagllevkiatvigfplGgslldvkvaeaeaaveaGadeidlvi
00496291   1/1  aeavpiplqvgggi.............rslediellleagadkvi...igsaaledpelvaelakafgkq
00416581   1/1  elaklidltlLkpdateedieklcdeAleygfaavcvnpvfvklakellkgsdvkvatvigFPlGgstle
00514421   1/1  --lmeiipaidlldgklvaevkgplpvllvgpdpedlaelaeaaeeaGadaievndldpikairkavdvp
00480291   1/1  agikpigvnl.gkpgeggalaaikvseagadaidlnlgaplvdpvvdvgsistlggdpelvledlkalre
00470261   1/1  llglklslPliiapmagvtllhpdgeaalaraaaraGglgv.lgsgslapeeevrkaapg..pfgvnlyg
00496611   1/1  sailldpglalaaaldfvalgadvgllvdldgafvlaptngdlggllslesveaav...eaGadavklgl
00500031   1/1  apdiplivnlggnkltedavedyvelarrlee.gadalelnvssPntpglrelqlglalgllpelllevv
00471251   1/1  dpleiaklleeagadalhvvdldaplaggptileaikralkavdipvlvgggirdledae..........
00498481   1/1  lkglgvivitvvgfplggstlevkaeeaeaaveaGadeidlvincgalkag..........dpelvleli
00511641   1/1  kgklivsvqlaldsplrdtvdlaeaAkaaaeaGadgiringgepikkvkkavdlpvvgiilrdlpdspvi
00501351   1/1  apggplgvnlggaqdaepgveeaaraaeeagadalelnvdlpqlgsreld.......rprlllellealr
00486611   1/1  ---------------edfaeaArraieaGfdgveihaAhgyLldqFlspltNkRtDeYGGslenrarfll
00366281   1/1  mkisplivalDfpdleealeladalge.gvdvikvgtplvla......fgp..........evvkalrka
00489981   1/1  -----------------------------ledvellleagadkvii...gsaalkdpellkelakafg.k
00411521   1/1  lgglkvaavvgfPlGasttedkveeakaaveagadeieinishgnl..........legdlelllelika
00476511   1/1  rdgvpvyatlgggdpeelaeaaeelldeGftavkikvgap...............dleldlelveavrea
00457121   1/1  kkriipaidlkdglvvrlvqgdlaliaevkkaspskgvidfdpveiak.yeeaGadalsvlt.ddgafgg
00472421   1/1  llglklslPlviapmagvtllhpdgeaalaiaaaeaGglgvlgtgssas.ieevkkaapg..plivqlyv
00450461   1/1  imllkriylildvdiedllelaeaaleaGadaiqlrvkdpspe............gllelaeaikelakk
00426111   1/1  egrgypgtpgiwsdeqveglkkltdavhaaggkiflQLwhaGrvaspslllggllpvaPSaiplpgglll
00487681   1/1  -------------------------------------------------------------ddlkavrea
00448031   1/1  gtpgiwsdeqieglkkltdavhaagakiflQLwhaGrvaspalllggllpvaPsaiplplelllalllll
00502011   1/1  ----------------------------------------------------------------------
00497391   1/1  ---------------------akrledaGadailvtggpggtg...........................
00495871   1/1  llgiklslPliiapmggvtllspdgepalaraaaraGglgvlgsgslglee..evrkakpdgplivnlya
00416931   1/1  ----------------------kllsGviaalvTpfddgeidldalaklidfligagvdglvvlGttGea
00389721   1/1  gtpgiwsdeqieglkklvdavhakgakiflQLwhaGrvaspdllpggllpvapsaiplplelllllllll
00484451   1/1  rdrvpvyatlgggdpeelaelaeealeaagfraiKlkvgap...............dleldlerveavre
00449281   1/1  -----------------------------------------prkgliagnwkmygdpaelaeliealgaa
00491461   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TQIPVTVKTRIGIDEQDSYEALDHFISTVAQAGCRTFIIHARKAWLQGLSPKENREKPPLRYDVVRTIKQ
00447601   1/1  avpipvtvkirlgwdledtve....lakaleeaGadaltvhgr........trsqrytgpadleaikevk
00471401   1/1  aielnlgcPntkvlrg.ggaallqdpellleivkavreavgipvivKlrpggd......dtvelaraaee
00518991   1/1  rlleagadaielnigcp.....ntgggaallldpelllelikalreavgipvivKirpgidtaedve...
00465991   1/1  igcpntpv....lgallakdpelvaivvaavkkavkvpvvvkivpgvdd......lveiakaleeaGada
00424451   1/1  ltleeieeiiedfaeaarraleaGfdgveihgahgyLldqFlsplsnvrtdeyGgslenrprlllevvea
00384291   1/1  vaPSaipapggvfllllllelalvafvvpraltveeikriiedfaeAArraieaGfdgveihgAhgyLld
00497081   1/1  kalkallllllleaggplivqiggsglfgsrpedlaeaaellepl.adaielnlscPakpglggllgaal
00524811   1/1  eeagadailelnlgcp.....ntlggsallkdpelllelleavkeavdvpvivKispgvgiedied....
00467211   1/1  ipvganlgvdeilplgarvedfaeaarlaee.gadaielnfssPnlpnlrsdeyggslenrprllleiik
00397811   1/1  Gadaviigsaaltnpdeahgyllsqfllpllaelakeygaqaivvgidakrgkggaallddpelveaive
00526101   1/1  vdvpvvlkgginpilrigvdgvlipdlpveepeefaeaaaeagadiivlhapttgdlrlikeaggfayvv
00514891   1/1  ltleeigeiiedfaeaAkraieaGfdgvelhgahgyLldqFlspltnvrtdeyGgslenrarfllevvea
00383081   1/1  llllllllgllallagavpralteeeieeiiedfaeAArraieaGfDgveihgAhgyLldqFlspltnkr
00503221   1/1  ellkafgsqvvvsvdvkiglvatdgwle..sgldavelakkaeeaGadaiiltgi.......drdgtlgg
00362581   1/1  lravrlavvkraapdvpvgvnlggnkpaefgvddyelarraleaGadaivlnvsapnlpglrkdqgggal
00399921   1/1  ireavgipvivgggirspedaralleaGadavivgsalledpellaellealgpevivvaidvkavgvpv
00515981   1/1  vsvpvivkgrigsdedvelalaagadgvtvgtlagedpeelleaakelglpvivgardakealraarlgr
00364571   1/1  lllllvpraltveeiaeiiedfaeaArraieaGfdgveihgahgYLldqFlspltnkrtdeyGgslenra
00394821   1/1  nl..........gallsgdpeevleeiravveaakdlgvpvkviletglltdveflveaaraaaeaGAdf
00496291   1/1  aivvsvdvkrvdgdglvatrggleltgvdlvelakaaeeaGadailvtsi.......drdgtlsgp..dl
00416581   1/1  vklaeaklaieaGadeidlvin..........igallggdpelvyeeikavreacg.pvvvKviletgdl
00514421   1/1  vivkdfiglplavggglrdpeeaeaaleaGadgvvlgaaagyllgle..llaelvkaakelgpglivlvg
00480291   1/1  avgvpvivKlvptved..........AkaaeeaGaDaivvsgaGGtg...........ldvgpptleala
00470261   1/1  lkdpellaellrraeaagadaivltvglpvlgvrerdlrlgfllppaaggalladlaralalvlagadel
00496611   1/1  yygsdkeaeq.....aledlervrelcralglplvvelvarggrlgwakvdpeliad.aareaaelGadi
00500031   1/1  eavkkavglpvivKlapdlteediaeiaraae....eagadgiivtNttggrlldlepllgveagglsga
00471251   1/1  ...illnaGadvvii.....gsalltdpeliaelakavgagvivvdldvrlgeglaevatkggle..vtp
00498481   1/1  kavreavg.gvpvkviletgll.tveeiveaaraaveaGadfiktst.....gggsggatlevlalivea
00511641   1/1  idptleevdalleagadvvaldatalprpelveelvelvkkaltlgllvladva.....tvee....Akr
00501351   1/1  eavgvpvivKlvggvltved.......aralleaGadaivvsgggggghidvetlravgaattggllgvg
00486611   1/1  evvdavreavgadpvgvRlspldlveggltledsnplellvelakaleeagadgkg..vdylhvsegtye
00366281   1/1  pglpvildlKladign....tveaaaeaaaeaGadaitvhgyagsdtlkelleaakelglgvlvllspst
00489981   1/1  ivvsldakggkvatrgwlel..tgvdavelakrleelgadeilvtsidrdgtlsgp.........dlell
00411521   1/1  ikeavg.gvvvkvilgtvll.deeeivelaealieaGaDgikvsgGfggi........gatlealrliae
00476511   1/1  vgpdiplrvDanggwtleeairlakalee....agygllwi................EePlpaddlegla
00457121   1/1  ..............slellkaireavslpvlvkggir.dpyqveealaaGadavllgaaalsdpelvell
00472421   1/1  ldretteellkraeaagadalvltvdapllgirerdlrlgfglppglgglntldlvvipegrllgadvil
00450461   1/1  vdvplivndg...............velaleagadgvhlggpdllleaarelglgvivgvsvhtleeale
00426111   1/1  llldlgllllvvtpralteeeieeiiedfaqAArrAieaGfDgveihgAhgYLldqFlspltNkRtDeYG
00487681   1/1  vdlPvlvkdfi.idpyqigearaagAdavlLivadlpdeeleelleaarelgldvlvevhdleelerala
00448031   1/1  lllvpralteeeieeiiedfaqAArraieaGfDgveihgAhgyLldqFlspltNkRtDeYGGslenRarf
00502011   1/1  -------------------------------------------------------------iellkalre
00497391   1/1  ........................................................lgvadlellrevae
00495871   1/1  skdrgvlaelleraeeagadaivltvdspllgqrardlrggfllglkvtaeilalrlvppgealispahg
00416931   1/1  lllsleErlelveavveavggrvpviagvga...nstreaielaklaeelGadailvlppyydk......
00389721   1/1  llvvpralteeeikeiiedfaqAArrAieAGfDgveihgAhgYLldqFlspltNkRtDeYGGslenRaRf
00484451   1/1  avgpdvrlrvDanggwdleeairlakal....eeygllwi..................EePlpaddlegl
00449281   1/1  llsvltgvvlfvgpppidlaavrealdipvlaknvlpnesGaftgevsvellleaGadgvilghserrla
00491461   1/1  -------------------------------------------------------------lelvkevkk


                         -         -         -         +         -         -         -:280
query           DFPQLTVIINGGITTLEEISEHLELLDGVMIGRAAYHNPYLLAQVDRNFYGDFHPFLTRHEIIEAFLPYV
00447601   1/1  e...sipvianGgirtpedaakaleatGadgVmigraalgnpelfgeikeglggegivvigakevlelll
00471401   1/1  aGadgiivhnrtgtqlidvearkallglglgsinetgglsgpaippa-----------------------
00518991   1/1  .iakaleeaGladaiivsnrtggtlaadigpgsllttrlvehgglsgda...lpplalellaevaeavgd
00465991   1/1  iivtnttagghlglellkpilkvgigglsgrplrplalelvpqla-------------------------
00424451   1/1  vreavgadfivgvRlspddlvgggltleeavelakaleeaGadyihvsgg..------------------
00384291   1/1  qFlspltnkrtdeyGgslenrarfllevveavreavgdfpvgvrlspldlvggmarlgl....tledave
00497081   1/1  ledfiaaarraveagadiielgiasgylldgfliplanlraleyGndpelllelikalreavgvP-----
00524811   1/1  iakalveaGadaivvsnt...thggrqldiegvdlivaqgpeagglsGnalapaaleliaeiadavkgdi
00467211   1/1  avreavgedvpvivKlspgldvedied....lakaleeaGadaiivsng---------------------
00397811   1/1  avkeavpvpvtvkirggtelgd..idavelakaleeaGadailvtgrtr..dgtls.....---------
00526101   1/1  lnpgtsvagvtgarpvlglvdlvlaaavaeglsglliiyleadgtpv-----------------------
00514891   1/1  vreavgfpvgvrlspldlvegglnleeavelakaleeagvdllhvshg.....rtsglstpai-------
00383081   1/1  tdeyGGslenrarfllevveavraavgdfpvgvRlspldlveggldsltleealelakaleeagvdylhv
00503221   1/1  p..dlellrevaeavd.ipviasGGigsledlaaalellalGadgvl-----------------------
00362581   1/1  lpdpelvlelikalkeavglpvivklapgltgvdtvelakraee....a---------------------
00399921   1/1  tvkirggldltd..vdavelakaleeagadailvt.........g-------------------------
00515981   1/1  ealrtkgikllpdvvttvea.araaeeaGadvigvtggdltgtkrla-----------------------
00364571   1/1  rfllevveavraavgadfpvgvRlspddlvegggltledavelakaleeag-------------------
00394821   1/1  ikvsd......Ggtvg..gatpeavallvealrevavgv-------------------------------
00496291   1/1  ellkevaeavs.ipviasGGigsledaaellaaGadavlvGsallggplllkeikelleel---------
00416581   1/1  .dleeiveaakaaaeaGadfikts......tGfggg..gatlealrli----------------------
00514421   1/1  vltleeakaaeeaGadaigvsnigltgtvagvgpp........dl-------------------------
00480291   1/1  evaealgelglrgripviadGGirtgedaakalalGAdaVmvGr--------------------------
00470261   1/1  vlvvsdgdpeglleliealreatgvpvivkgvatved..........araaaeaGadaivvsggggggl.
00496611   1/1  lkvevptdagtlegpn...........lealrevveavgiPwvilsGGv.sspefleavkaai-------
00500031   1/1  alkplalrlvaevreavggdipiigvGGIrtgedalealaaGAsaVq-----------------------
00471251   1/1  idavelakraeelgadailltsrt.vtgtlsgpd........lel-------------------------
00498481   1/1  vgg......kipviaaGGirtaedalkalaaGAd------------------------------------
00511641   1/1  aeeaGadaigv....gvhggtdvtkdgglggpdlellkevveav.dipv---------------------
00501351   1/1  vptlal..laevrealgdipviadGGirtgedaakal---------------------------------
00486611   1/1  dlv..stpvpegyfldlaaairkavg.ipviavggitltpedaeealeega.dlvalgRalladPdlvlk
00366281   1/1  egllelllelvllvaylavelgvdgvvvgat.nlellkeirellgd------------------------
00489981   1/1  kklaeavs.ipviasGGigsledlkellelsnlletgadgvlvgs-------------------------
00411521   1/1  vvke...kipiiadGGIrsgedalkalaaGAdlvgvgsalaileellglleel-----------------
00476511   1/1  elreavg.ipiaadEsvtsledlkelleagaadavqiklakiGgltealkiaalAeaaglpvvvhssles
00457121   1/1  elakelglevlvevhtleeakralelgadligvnnrdgttggvd...-----------------------
00472421   1/1  ldaahgdplllleliealrealgvpvivkgvatved..--------------------------------
00450461   1/1  aeelgadyillgpvfptgtkpgfgplglellrelveav.kipviasG-----------------------
00426111   1/1  GslenRarfllevveavreavg.dfpvgvRlspldlveglldldplelg---------------------
00487681   1/1  lgadiigvnnrgltglevdldtllellklvpe...dipvvaegGIstped--------------------
00448031   1/1  llevveavreavgadfvlgvrlsatdfvegglsltleealelaklleeagldylhvsegrve--------
00502011   1/1  avg.ipvviagGGistpedaaellegAdgvvvGsaifkgedplkeaieflka------------------
00497391   1/1  av.diPviadGGIgtpedaakalelGAdgVlvGsaiagaedPgemaralkl-------------------
00495871   1/1  dpilsledlkalrealgvpvivkgvltved.......---------------------------------
00416931   1/1  ...psqegllahfkavaeavd.lPvilYniPgrtgvdlspetlarlaeeipnivgiKdasgdlgrlerll
00389721   1/1  llevveavreavg.dfpvgvRlspldlveggldsltleealelakaleelgldylhvsegrve.......
00484451   1/1  aelrealg.ipiaadEsltsledlrrlleagavdiiqiklaklGgltealkiaalAeaaglpvvphsale
00449281   1/1  lgepdelieaakklglkvivcvgevlearralalgad---------------------------------
00491461   1/1  at.dipvivggGIstpedakealeaGAdgvvvGsaivkaidgalaieelleavkelvea-----------


                         -         *         -         -         -         -         +:350
query           AEQLVQGVYLNHMTRHILGLFQGQPGARAWRRHLSENAHRPGAGIEIIREALRQMPC-------------
00447601   1/1  eylellleyggellgvlrllkhllrllkglpgagelrltln.dadgllegldllee--------------
00471401   1/1  ----------------------------------------------------------------------
00518991   1/1  ip--------------------------------------------------------------------
00465991   1/1  ----------------------------------------------------------------------
00424451   1/1  ----------------------------------------------------------------------
00384291   1/1  lak-------------------------------------------------------------------
00497081   1/1  ----------------------------------------------------------------------
00524811   1/1  pviad-----------------------------------------------------------------
00467211   1/1  ----------------------------------------------------------------------
00397811   1/1  ----------------------------------------------------------------------
00526101   1/1  ----------------------------------------------------------------------
00514891   1/1  ----------------------------------------------------------------------
00383081   1/1  sggtve.........gvpegaf------------------------------------------------
00503221   1/1  ----------------------------------------------------------------------
00362581   1/1  ----------------------------------------------------------------------
00399921   1/1  ----------------------------------------------------------------------
00515981   1/1  ----------------------------------------------------------------------
00364571   1/1  ----------------------------------------------------------------------
00394821   1/1  ----------------------------------------------------------------------
00496291   1/1  ----------------------------------------------------------------------
00416581   1/1  ----------------------------------------------------------------------
00514421   1/1  ----------------------------------------------------------------------
00480291   1/1  ----------------------------------------------------------------------
00470261   1/1  .......dvgvptl--------------------------------------------------------
00496611   1/1  ----------------------------------------------------------------------
00500031   1/1  ----------------------------------------------------------------------
00471251   1/1  ----------------------------------------------------------------------
00498481   1/1  ----------------------------------------------------------------------
00511641   1/1  ----------------------------------------------------------------------
00501351   1/1  ----------------------------------------------------------------------
00486611   1/1  laeglelneidrcif-------------------------------------------------------
00366281   1/1  ----------------------------------------------------------------------
00489981   1/1  ----------------------------------------------------------------------
00411521   1/1  ----------------------------------------------------------------------
00476511   1/1  giglaaalhlaaalpnilileldtpllladdlftgplviedgyllvp...--------------------
00457121   1/1  ----------------------------------------------------------------------
00472421   1/1  ----------------------------------------------------------------------
00450461   1/1  ----------------------------------------------------------------------
00426111   1/1  ----------------------------------------------------------------------
00487681   1/1  ----------------------------------------------------------------------
00448031   1/1  ----------------------------------------------------------------------
00502011   1/1  ----------------------------------------------------------------------
00497391   1/1  ----------------------------------------------------------------------
00495871   1/1  ----------------------------------------------------------------------
00416931   1/1  rlleltgddfavlsGldllllpala---------------------------------------------
00389721   1/1  .ipvge----------------------------------------------------------------
00484451   1/1  sgiglaaalhlaaalpnlliledldtpllladdlfkgpleiedglllvp...dgPGlG------------
00449281   1/1  ----------------------------------------------------------------------
00491461   1/1  ----------------------------------------------------------------------