[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA59415.1


[Show Plain Result]

## Summary of Sequence Search
   1::490
 140::490  2.2e-27 19.3% 0048764 00487641 1/1   s                                       
 142::490    5e-07 16.2% 0053278 00532781 1/1   s                                       
 133::490  1.1e-06 15.4% 0048638 00486381 1/1   s                                       
 133::490  0.00048 15.2% 0047258 00472581 1/1   s                                       
   1::490


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRKKESLVGVGLAALTLAVSLPLGATEMPQTMEEMWRIIQQQQQEIEALKAKSQPLETEKAHPEISKEVP
00487641   1/1  ----------------------------------------------------------------------
00532781   1/1  ----------------------------------------------------------------------
00486381   1/1  ----------------------------------------------------------------------
00472581   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EKTKEATKTTTSTSEENAETKAQVKELEHKTGVLAEAVESLRTAMHIPEEFEYKSMYGLGPAASKVYQVG
00487641   1/1  ---------------------------------------------------------------------a
00532781   1/1  ----------------------------------------------------------------------
00486381   1/1  --------------------------------------------------------------aevyaaaq
00472581   1/1  --------------------------------------------------------------aevyahaq


                         +         -         -         -         -         *         -:210
query           KGLSIGGYGEGRYQTFVNGDGDDNADFARLVLYTGYKFTDRIIFNSEIEFEHGTTGEGAEEKGEVSVEFA
00487641   1/1  alaaaaqssvtlyGfvdagvtytdnddgdgglsgsrlglkgsedlgdglkavfqlEsgfnl.dngagggg
00532781   1/1  -svtlyGvvdagvey..ddvtsgglsgsraelglkgsedlggglkaifqlesgfnldng...........
00486381   1/1  ssvtlyGridagveyvdngltsgglsgsrlglkgsedLggglkaifqlEsgfnlnnga.gsggrlftRqa
00472581   1/1  ssvtlyGrvdagveyvdnggslvsltsgglsgsrlglkgsedlggglkaifqlEsgfnldngallgqggr


                         -         -         -         +         -         -         -:280
query           ALDFFLDPRVNIRAGLVLMPMGFINLIHEPPFFFGNNRPEVERRIIPSTWREIGVGLFGELLPGLTYTMY
00487641   1/1  elflrqayvglkfgdfgtltlGrqytpfgdlvaltdpfgafggdsgdl.dnllgttrldngvkytspdfl
00532781   1/1  .rqayvglsgdfGtltlGrqytplydvlgltdpfgaaggdsagllaggl......gdlgalgggrvdnai
00486381   1/1  yvGlssgdfGtltlGrqytplydvlgatdpfgyfgg............dagdldnlgtgrvdnsvkYrsp
00472581   1/1  lfgRqayvGlksgdfGtltlGrqytplydvlgltdpfgaygg............dpgdldnlgtgradns


                         -         *         -         -         -         -         +:350
query           GVNGLNAEEFSSRGIRDGRQSGSKALAEDLAFVGRMDYAPPGMPGLSFGGSAYAGNSGQDQSYGGQDLDV
00487641   1/1  glvggltlgasyafgdd..............gvagdldngdgygagltYelgp.fglslgaaylqgdldl
00532781   1/1  kY.spsfgglsfgasys....fgevag.ldfsngdgygaglsYd...ngglslgaaylyannaaa..aga
00486381   1/1  dlfglfgglsfgasyafgnnagslggntlggvllgddngdgygagltYdlgd..gltlgaaysssddtna
00472581   1/1  vkYtspdffglfggltf..gasyafgnddvagsf..sngdgygagltYdng...glslgaaysqldndng


                         -         -         -         -         *         -         -:420
query           FTQLYEGHLQWQYRGWWLRALGAWGHIGDAEALSAAKGETIGESNFGWYTELAYNLLPLVWPETIQYLAP
00487641   1/1  daaglatlsdddaqayglgasydfggltlgaeytytdndgaagl......ggaldsdgyylgagYqlt..
00532781   1/1  ddl....dayglgasydfggltlgasytrtendgtlalllagllgadaagdavdsdgyelgasyql.g.a
00486381   1/1  tttdgnlgaddadayglgasydfggltlgasytytdnsdadg.....ldlgardtdgyelgaaYqltpal
00472581   1/1  tvgggtaggddadayglgasydfggltlgalyqytkndgagggtlllkdgnandtdgyelgaaYqlt...


                         -         -         +         -         -         -         -:490
query           FFRFEQLNTIASAPAGFSDKGGINQDIYQVGINYKPIPNVVIKADYRNFVGRDGNPSAADEFNLGLGFIF
00487641   1/1  ......paltlsagyaytda.........ddlagggpdadrtqvslgadYklskntslyaeyayvkndga
00532781   1/1  ltlsagyaytdad................gdd.danqvslgadYalskrtslyaeyayvdndg....dqd
00486381   1/1  tlragyay....tdakddgtt.........gddddynqvslgadYklskntslyaeyaylladgadstta
00472581   1/1  ..............paltlragyaytdakddggagddadatqvslgadYalskrtslyaeyaylladgnd