[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA59494.1


[Show Plain Result]

## Summary of Sequence Search
   1::249
   1::241  1.4e-68 42.9% 0048998 00489981 1/1   ose-phoshate binding barrel             
   1::243  1.1e-65 41.1% 0049629 00496291 1/1   ose-phoshate binding barrel             
   1::241  2.1e-63 40.9% 0050322 00503221 1/1   ose-phoshate binding barrel             
   1::249  1.1e-58 36.1% 0047125 00471251 1/1   ose-phoshate binding barrel             
   1::239  3.5e-53 38.1% 0039781 00397811 1/1   ose-phoshate binding barrel             
   3::236  1.5e-51 32.2% 0039992 00399921 1/1   ose-phoshate binding barrel             
   1::241  1.2e-49 37.1% 0049661 00496611 1/1   ase                                     
   1::238  3.7e-44 37.1% 0045712 00457121 1/1   ose-phoshate binding barrel             
   6::243  1.8e-40 33.2% 0050201 00502011 1/1   inked oxidoreductases                   
   1::240  6.8e-39 31.2% 0049739 00497391 1/1   like                                    
  23::241  1.8e-34 26.8% 0051598 00515981 1/1   ose-phoshate binding barrel             
   1::241  1.1e-31 32.5% 0051442 00514421 1/1   ose-phoshate binding barrel             
  31::236  3.9e-30 27.7% 0046599 00465991 1/1   inked oxidoreductases                   
   9::239  9.6e-29 27.8% 0052610 00526101 1/1   inked oxidoreductases                   
   8::241  9.8e-27 26.2% 0051164 00511641 1/1   ose-phoshate binding barrel             
  14::243  1.3e-26 24.7% 0045046 00450461 1/1   in phosphate synthase                   
  31::230  4.4e-22 28.0% 0049721 00497211 1/1   like                                    
  30::243  1.8e-21 27.5% 0038583 00385831 1/1   ephosphate isomerase (TIM)              
  30::247    2e-18 18.2% 0047889 00478891 1/1   ose-phoshate binding barrel             
   6::145  2.5e-18 28.5% 0038429 00384291 1/2   inked oxidoreductases                   
   1::109  3.5e-15 25.9% 0038072 00380721 1/2   ose-phoshate binding barrel             
 148::238  1.3e-12 27.9% 0038429 00384292 2/2   inked oxidoreductases                   
  31::241  8.1e-12 24.2% 0048768 00487681 1/1   ose-phoshate binding barrel             
  31::248  8.4e-12 19.9% 0047101 00471011 1/1   ose-phoshate binding barrel             
 144::227    6e-10 28.4% 0036258 00362582 2/2   inked oxidoreductases                   
 150::237    1e-09 34.1% 0044928 00449282 2/2   ephosphate isomerase (TIM)              
  30::135  2.3e-09 23.3% 0044760 00447601 1/2   inked oxidoreductases                   
 135::228  3.1e-09 26.8% 0047140 00471402 2/2   inked oxidoreductases                   
  32::121  5.4e-09 21.3% 0044928 00449281 1/2   ephosphate isomerase (TIM)              
 144::237  9.8e-09 30.8% 0051899 00518992 2/2   inked oxidoreductases                   
  20::119    1e-08 26.5% 0039482 00394821 1/2   ase                                     
  32::134    9e-08 21.8% 0049146 00491461 1/2   ose-phoshate binding barrel             
  31::248  1.2e-07 23.4% 0049228 00492281 1/1   ose-phoshate binding barrel             
 144::237  1.7e-07 28.6% 0049708 00497082 2/2   inked oxidoreductases                   
 138::243  2.5e-07 29.2% 0041693 00416931 1/1   ase                                     
  31::245  2.7e-07 20.4% 0052714 00527141 1/1   ose-phoshate binding barrel             
 144::240  4.3e-07 30.9% 0046721 00467212 2/2   inked oxidoreductases                   
  30::121  4.4e-07 23.9% 0049708 00497081 1/2   inked oxidoreductases                   
  30::121  4.5e-07 19.6% 0046721 00467211 1/2   inked oxidoreductases                   
  36::121  4.7e-07 18.6% 0047140 00471401 1/2   inked oxidoreductases                   
 147::243  5.3e-07 29.8% 0052481 00524812 2/2   inked oxidoreductases                   
 148::240  8.5e-07 24.7% 0044760 00447602 2/2   inked oxidoreductases                   
  29::121  8.8e-07 31.2% 0036258 00362581 1/2   inked oxidoreductases                   
  27::121  1.3e-06 22.1% 0051899 00518991 1/2   inked oxidoreductases                   
  30::121  1.5e-06 27.5% 0052481 00524811 1/2   inked oxidoreductases                   
 144::227  2.6e-06 25.6% 0042445 00424452 2/2   inked oxidoreductases                   
  17::243  3.3e-06 21.7% 0047651 00476511 1/1   se C-terminal domain-like               
 138::234  9.4e-06 19.8% 0041658 00416582 2/2   ase                                     
  30::125  1.5e-05 19.4% 0041152 00411521 1/2   ase                                     
 144::226  1.8e-05 24.7% 0049848 00498482 2/2   ase                                     
  30::105    3e-05 21.9% 0049848 00498481 1/2   ase                                     
 150::228  3.6e-05 27.6% 0047026 00470262 2/2   inked oxidoreductases                   
  31::246  4.3e-05 20.1% 0049674 00496741 1/1   ose-phoshate binding barrel             
  33::111    5e-05 25.3% 0047026 00470261 1/2   inked oxidoreductases                   
  33::150    6e-05 20.5% 0050135 00501351 1/2   inked oxidoreductases                   
  32::109  6.7e-05 24.7% 0049004 00490041 1/2   ose-phoshate binding barrel             
 147::240  7.8e-05 25.3% 0050717 00507172 2/2   like                                    
  31::112  8.7e-05 25.0% 0050717 00507171 1/2   like                                    
  15::124  0.00011 21.1% 0042445 00424451 1/2   inked oxidoreductases                   
  32::115  0.00016 22.9% 0049675 00496751 1/2   ose-phoshate binding barrel             
  15::127  0.00023 20.7% 0038308 00383081 1/2   inked oxidoreductases                   
 139::227  0.00023 27.9% 0038308 00383082 2/2   inked oxidoreductases                   
  33::110  0.00029 23.4% 0047242 00472421 1/2   inked oxidoreductases                   
 147::249  0.00032 17.2% 0038072 00380722 2/2   ose-phoshate binding barrel             
  29::117  0.00038 25.0% 0052356 00523561 1/2   ose-phoshate binding barrel             
  30::105  0.00049 29.6% 0041658 00416581 1/2   ase                                     
  15::135  0.00059 19.2% 0051489 00514891 1/2   inked oxidoreductases                   
 150::243  0.00059 26.4% 0049146 00491462 2/2   ose-phoshate binding barrel             
 171::241  0.00075 23.9% 0050132 00501322 2/2   ose-phoshate binding barrel             
 137::238  0.00083 21.5% 0048294 00482942 2/2   ase                                     
  44::111  0.00084 26.9% 0036628 00366281 1/2   ose-phoshate binding barrel             
 144::237  0.00088 22.3% 0036457 00364572 2/2   inked oxidoreductases                   
 144::235   0.0015 25.8% 0050003 00500032 2/2   inked oxidoreductases                   
 147::233   0.0015 25.3% 0039482 00394822 2/2   ase                                     
  36::149   0.0017 20.4% 0048029 00480291 1/2   inked oxidoreductases                   
  29::120   0.0019 25.0% 0050003 00500031 1/2   inked oxidoreductases                   
  32::121   0.0029 23.0% 0049922 00499221 1/2   ose-phoshate binding barrel             
 150::246   0.0031 26.1% 0049922 00499222 2/2   ose-phoshate binding barrel             
  15::122   0.0034 19.8% 0042611 00426111 1/2   inked oxidoreductases                   
 151::227   0.0038 25.7% 0047242 00472422 2/2   inked oxidoreductases                   
 138::242   0.0047 22.3% 0041152 00411522 2/2   ase                                     
  15::123    0.011 21.3% 0036457 00364571 1/2   inked oxidoreductases                   
 150::248    0.025 27.4% 0048029 00480292 2/2   inked oxidoreductases                   
  33::111    0.026 26.6% 0049587 00495871 1/2   inked oxidoreductases                   
 151::227    0.028 28.4% 0050135 00501352 2/2   inked oxidoreductases                   
 179::243    0.028 29.5% 0036628 00366282 2/2   ose-phoshate binding barrel             
  30::110    0.031 26.3% 0048294 00482941 1/2   ase                                     
  50::108    0.038 27.6% 0050246 00502461 1/2   ase                                     
 180::247    0.049 27.0% 0049675 00496752 2/2   ose-phoshate binding barrel             
 124::244    0.055 20.3% 0052356 00523562 2/2   ose-phoshate binding barrel             
  33::150    0.073 22.1% 0042110 00421101 1/2   inked oxidoreductases                   
 151::206     0.12 32.1% 0042110 00421102 2/2   inked oxidoreductases                   
 151::228     0.14 29.3% 0049587 00495872 2/2   inked oxidoreductases                   
 149::227     0.17 29.9% 0051489 00514892 2/2   inked oxidoreductases                   
 153::248     0.62 19.8% 0050246 00502462 2/2   ase                                     
 181::228      1.6 22.2% 0049004 00490042 2/2   ose-phoshate binding barrel             
 144::220        2 22.4% 0042611 00426112 2/2   inked oxidoreductases                   
  64::123      4.3 19.0% 0050132 00501321 1/2   ose-phoshate binding barrel             
   1::249


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLLIPAIDLKGGKCVRLRQGRMEDDTVFSDDPVAVALHWAEAGAKRLHLVDLDGAFAGQPVNADIIYHIA
00489981   1/1  mriiPaidlkdgkvvrlvqgdldenlvylgdpvelakayleagadelhvvdldgafegrgvnleviekia
00496291   1/1  mlamriiPaldlkdgrvvklvqgkllr...yagdpvelaklyleagadelhlvdldgallgrpvnlelik
00503221   1/1  lamriiPalDlkdgrvvrlvqgdldnlrvvg.dpvelaavyleggadelhvvdldgal.gpevlaeaiea
00471251   1/1  lmlkriiPaldlkdgkvv.lvkgvllvplvtagdpleiaklleeagadalhvvdldaplaggptileaik
00397811   1/1  gllglelpiriaPmldvtdglvvrllqgkygaalvykemvfsdllllgdpvelakayeeaGadalhvldl
00399921   1/1  --mlakriipaldlkdgrvvrlivgl...nggdpedpveaakaaeeaGadaielndldpallgpeallev
00496611   1/1  gkllrlerlsnrdgrllilAiDqrvslgpmlalkdgkavrlvsgledfktvvsealeagasailldpgla
00457121   1/1  llllstiLdkIvadkleevaalkkriipaidlkdglvvrlvqgdlaliaevkkaspskgvidfdpveiak
00502011   1/1  -----alldlkdgalvslldpdf.......gdpvelakaleeaGadalhlgdsdgaadgnliqgaevvla
00497391   1/1  mliipgldlks..rlvlgtgdy.......gdpvelakaikesgadiv.vvalrripav.irnrdllldli
00515981   1/1  ----------------------qgggidpedpaelaraaeeaGadaielndgcpfdsrlldgs..gllpd
00514421   1/1  lmeiipaidlldgklvaevkgplpvllvgpdpedlaelaeaaeeaGadaievndldp...........ik
00465991   1/1  ------------------------------pkdvpllstlilglklknPiilApmadvtdaelaaalala
00526101   1/1  --------lkkglivaltlgdpdk.....edlvelakaleeaGadaiel...dgsfgvtvenvlelvkav
00511641   1/1  -------dllkgklivsvqlaldsplrdtvdlaeaAkaaaeaGadgiri...........nggepikkvk
00450461   1/1  -------------iimllkriylildvdiedllelaeaaleaGadaiqlrvkdpspegllelaeaikela
00497211   1/1  ------------------------------lllEvcvdslesalaaeeaGadrleLvd.nlavggltpsl
00385831   1/1  -----------------------------eikrsslilgnwkmygdpaeiaklieaagaealsvltdldv
00478891   1/1  -----------------------------lsplilaldfpdleealellealadgvdvvelgfpl.plad
00384291   1/2  -----gveihgAhgyLldqFlspltnkrtdeyGgslenrarfllevveavreavgdfpvgvrlspldlvg
00380721   1/2  giiipdlpleelelvlelakelglklivlvapttpverlkevaelgagfiylvsltgvtggrkalpetll
00384292   2/2  ----------------------------------------------------------------------
00487681   1/1  ------------------------------dpveialaye.agadalsvltdekffqg...slddlkavr
00471011   1/1  ------------------------------lalisplilalDfadllealklleelgadlihldvmdggf
00362582   2/2  ----------------------------------------------------------------------
00449282   2/2  ----------------------------------------------------------------------
00447601   1/2  -----------------------------edtvelakaleeaGadaltvhgrtrsqrytgpadleaikev
00471402   2/2  ----------------------------------------------------------------------
00449281   1/2  -------------------------------evlearralalgadaiayepveaigtgkganpellpevv
00518992   2/2  ----------------------------------------------------------------------
00394821   1/2  -------------------viletglltdveflveaaraaaeaGAdfikvsd..Ggtvggatpeavallv
00491461   1/2  -------------------------------slerlkaiaklgdgflymvvipG.vtGqktgfipevlel
00492281   1/1  ------------------------------lpllslkmkklliapsilaldfadlaealkllleagadli
00497082   2/2  ----------------------------------------------------------------------
00416931   1/1  ----------------------------------------------------------------------
00527141   1/1  ------------------------------lmkispsilalDfadlaealklleelgadllhldvmdggf
00467212   2/2  ----------------------------------------------------------------------
00497081   1/2  -----------------------------edieeiakaleeaGadgiivsnttagghgrtslegvtggls
00467211   1/2  -----------------------------ediedlakaleeaGadaiivsngigggtgltplelagvhgg
00471401   1/2  -----------------------------------rkallglglgsinetgglsgpaippaaleliaevr
00524812   2/2  ----------------------------------------------------------------------
00447602   2/2  ----------------------------------------------------------------------
00362581   1/2  ----------------------------gvdtvelakraeeaGadavvvsnttggrgldgttrrvaeagg
00518991   1/2  --------------------------idtaedveiakaleeaGladaiivsnrtggtlaadigpgslltt
00524811   1/2  -----------------------------ediediakalveaGadaivvsntthggrqldiegvdlivaq
00424452   2/2  ----------------------------------------------------------------------
00476511   1/1  ----------------vrdgvpvyatlgggdpeelaeaaeelldeGftavkikvgap.............
00416582   2/2  ----------------------------------------------------------------------
00411521   1/2  -----------------------------eeivelaealieaGaDgikvsgGfggi.gatlealrliaev
00498482   2/2  ----------------------------------------------------------------------
00498481   1/2  -----------------------------eeiveaaraaveaGadfiktst...gggsggatlevlaliv
00470262   2/2  ----------------------------------------------------------------------
00496741   1/1  ------------------------------klyliaPsilaldfadllealkllleagadlihldvmdgg
00470261   1/2  --------------------------------vedaraaaeaGadaivvsggggggldvgvptlealpev
00501351   1/2  --------------------------------vedaralleaGadaivvsgggggghidvetlravgaat
00490041   1/2  -------------------------------plerlkliaelgsgfiylvslaGvTGarsevlppllell
00507172   2/2  ----------------------------------------------------------------------
00507171   1/2  ------------------------------ddlelakrleeagadavmplgeligsgig.lanpellrai
00424451   1/2  --------------vRlspddlvgggltleeavelakaleeaGadyihvsggtleglvplestpvpggad
00496751   1/2  -------------------------------plelleeilelslldlvllmsvepgfggqkfipsvleki
00383081   1/2  --------------vRlspldlveggldsltleealelakaleeagvdylhvsggtvegvpegafldlaa
00383082   2/2  ----------------------------------------------------------------------
00472421   1/2  --------------------------------vedarraleaGadaivvsghggggldvgiptlaalpev
00380722   2/2  ----------------------------------------------------------------------
00523561   1/2  ----------------------------seealealllgadyvavlavepgldgvvvgat.elellkelr
00416581   1/2  -----------------------------eeiveaakaaaeaGadfi...ktstGfggggatlealrlil
00514891   1/2  --------------vrlspldlvegglnleeavelakaleeagvdllhvshgrtsglstpaipgafldla
00491462   2/2  ----------------------------------------------------------------------
00501322   2/2  ----------------------------------------------------------------------
00482942   2/2  ----------------------------------------------------------------------
00366281   1/2  -------------------------------------------aylavelgvdgvvvgat.nlellkeir
00364572   2/2  ----------------------------------------------------------------------
00500032   2/2  ----------------------------------------------------------------------
00394822   2/2  ----------------------------------------------------------------------
00480291   1/2  -----------------------------------AkaaeeaGaDaivvsgaGGtg.ldvgpptlealae
00500031   1/2  ----------------------------eediaeiaraaeeagadgiivtNttggrlldlepllgveagg
00499221   1/2  -------------------------------slerlkaiaelgsgfiylvsllgvTGaktgvspdllell
00499222   2/2  ----------------------------------------------------------------------
00426111   1/2  --------------vRlspldlveglldldplelgltleealelakaleeagldylhvsegrveglvlli
00472422   2/2  ----------------------------------------------------------------------
00411522   2/2  ----------------------------------------------------------------------
00364571   1/2  --------------vRlspddlvegggltledavelakaleeagldylhvsggtreglvlliatlilvrg
00480292   2/2  ----------------------------------------------------------------------
00495871   1/2  --------------------------------vedallaaeaGadaivvsghggggldvgvptlealpev
00501352   2/2  ----------------------------------------------------------------------
00366282   2/2  ----------------------------------------------------------------------
00482941   1/2  -----------------------------eeiakaallaaeaGadfiktst..Gfllgga.tledvllml
00502461   1/2  -------------------------------------------------adyvklfpaepggpeylkalr
00496752   2/2  ----------------------------------------------------------------------
00523562   2/2  ----------------------------------------------------------------------
00421101   1/2  --------------------------------vedalllaeaGadaivv....sghgGrqldavevarsi
00421102   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00514892   2/2  ----------------------------------------------------------------------
00502462   2/2  ----------------------------------------------------------------------
00490042   2/2  ----------------------------------------------------------------------
00426112   2/2  ----------------------------------------------------------------------
00501321   1/2  ---------------------------------------------------------------ellelip


                         -         -         *         -         -         -         -:140
query           QALPDMDIQVGGGIRDSDTIQTYLDAGVRYAIIGTKAINAPHFVADACLEFPGHILLGLDAREGKIAING
00489981   1/1  e..vdiplqvgggirdledvellleagadkviigsaalkdpellkelakafg.kivvsldakggkvatrg
00496291   1/1  eiaeavp.iplqvgggirslediellleagadkviigsaaledpelvaelakafgkqaivvsvdvkrvdg
00503221   1/1  iae.ltdlpidvnggirsledaealleagadkviigtaalknpelvaellkafgsqvvvsvdvkiglvat
00471251   1/1  ralkav.dipvlvgggirdledaeillnaGadvviigsalltdpeliaelakavgagvivvdldvrlgeg
00397811   1/1  daafaggvtrgvllelikeiaeavp.ipvqvgggirsledlaaaiivfleaaiillnaGadaviigsaal
00399921   1/1  iraireavg.ipvivgggirspedaralleaGadavivgsalledpellaellealgpevivvaidvkav
00496611   1/1  laaaldfvalgadvgllvdldgafvlaptngd................lggllslesveaaveaGadavk
00457121   1/1  .yeeaGadalsvltddgafgg...slellkaireavs.lpvlvkggirdpyqveealaaGadavllgaaa
00502011   1/1  igkt.vdlplqvgggirslpdlliipilllag.dpiviig....edpflvdelakaigvdgvvvgdlval
00497391   1/1  rikdivliplgggirsaeeaklllgagveaiilntv...dpevideaavllpdviev.ldaakklvklgl
00515981   1/1  peiikavrkav.svpvivkgrigsdedvelalaagadgvtvgtlagedpeelleaakelglpvivgarda
00514421   1/1  airkavdvpvivkdfiglplavggglrdpeeaeaaleaGadgvvlgaaagyllglellaelvkaakelgp
00465991   1/1  ggggvlgktmtpepqagnpvprarrldeaginrlgfndlgaaaelrrllkll.vksiaevpiivnlvggg
00526101   1/1  ke.vdvpvvlkgginpilri......gvdgvlipdlpveepeefaeaaaeagadiivlhapttgdlrlik
00511641   1/1  kav.dlpv.vgiilrdlpdspviidptleevdalleagadvvaldatalprpelveelvelvk.......
00450461   1/1  kkv.dvplivndg......velaleagadgvhlgg.....pdllleaarelglgvivgvsvht.......
00497211   1/1  gllkavleavd.ipvhvmirprggdfvysdleliimlddidlalelgadgvvlGaldldgpldvelleel
00385831   1/1  afapsftdlaevrkavk....ipvlaqdvlivggGirtgedavemlkdaGvdgvilghserrlllgelde
00478891   1/1  gpeliealrklvpglpvfldvklgdnpetvvelaaeaGadgvtvhala..gpdlleelleaikkaglllg
00384291   1/2  gmarlgltledavelakaleeaGadylhvsdgdgag.geganlelieaireavg.ipviasGgi.tpeda
00380721   1/2  elirrireav.dvpvivggGistpedvaelleaGAdgvv-------------------------------
00384292   2/2  ----------------------------------------------------------------------
00487681   1/1  eav.dlPvlvkdfiidpyqigearaagAdavlLivadlpdeeleelleaarelgldvlvevhd.......
00471011   1/1  vlnltfgpeivkalrkl.tdlpldlhliindvekfielaaeagadgitvhaeagletleaaikaikklg.
00362582   2/2  ----------------------------------------------------------------------
00449282   2/2  ----------------------------------------------------------------------
00447601   1/2  ke...sipvianGgirtpedaakaleatGadgVmigraalgnpelfgeikeglggegivvigake-----
00471402   2/2  ----------------------------------------------------------------Klrpgg
00449281   1/2  eavrallelapdvpviagGGigtgndaaaalalGadgVlvGsallkaed.p-------------------
00518992   2/2  ----------------------------------------------------------------------
00394821   1/2  ealrevavgvkipvhasGGirtdedaakalalaaveaGadqvgadavgi---------------------
00491461   1/2  vkevkkat.dipvivggGIstpedakealeaGAdgvvvGsaivkaidgalaieelleavkelve------
00492281   1/1  hldvmdggfvpnltfgpeiikalrk.ltdlpidvhlmindienyvelaaeagadgitvhqealpledlee
00497082   2/2  ----------------------------------------------------------------------
00416931   1/1  -------------------------------------------------------------------iag
00527141   1/1  vlnltigpeivkalrkl.tdlpldvhlmindteklielaaeagadgitvhaeageellealkaikklgkk
00467212   2/2  ----------------------------------------------------------------------
00497081   1/2  glpllpasleliaalrealggripviavGGIrtgedaakalaaGAdgVmvg-------------------
00467211   1/2  lsglplapaslevlaelreavggripviadGGirsgedaakalalGAdaVm-------------------
00471401   1/2  eavpgipvianGGIrtgedalealaaGAdaVmvgsallgtgpalveeileg-------------------
00524812   2/2  ----------------------------------------------------------------------
00447602   2/2  ----------------------------------------------------------------------
00362581   1/2  lsGaplkpaslellreiaeavggdipviadGGIrtgedaakalaaGAdaVq-------------------
00518991   1/2  rlvehgglsgdalpplalellaevaeavgdipviadGGIrsgedaakalal-------------------
00524811   1/2  gpeagglsGn.alapaaleliaeiadavkgdipviadGGIrsgedaakala-------------------
00424452   2/2  ----------------------------------------------------------------------
00476511   1/1  ...................................dleldlelveavreavgpdiplrvDangg......
00416582   2/2  -------------------------------------------------------------------ile
00411521   1/2  vke..kipiiadGGIrsgedalkalaaGAdlvgvgsalaileellglleelggss---------------
00498482   2/2  ----------------------------------------------------------------------
00498481   1/2  eavggkipviaaGGirtaedalkalaaGAdavgvg-----------------------------------
00470262   2/2  ----------------------------------------------------------------------
00496741   1/1  fvpnltigpeivkalrk.ltdlpldvhlmindvekyielaaeagadgitvhqedlaledlkrllklikkl
00470261   1/2  aeavggdipviadGGIrtgedvakalalGAdgVlvGtafly-----------------------------
00501351   1/2  tggllgvgvpt.lallaevrealgdipviadGGirtgedaakalalGAdaVlvgrallyaleaggegvpk
00490041   1/2  erirel.tdlpvlvgfGistpeqvkaaleaGAdgvvvGS-------------------------------
00507172   2/2  ----------------------------------------------------------------------
00507171   1/2  aea.vkvPVivdGGIgtpsdaaaamelGadgVlvgtaiakak----------------------------
00424451   1/2  lelaravreav.sipviavggirtpedaeealeaggadlvavgraflanPdlva----------------
00496751   1/2  kelrkligdipiivdGGin.petikkaieaGadivvvGsaifkae-------------------------
00383081   1/2  avrkav.kipviavggi.dpelaeealeeggaDlvaigRaflanPdlvlklaeglpl-------------
00383082   2/2  --------------------------------------------------------------------gg
00472421   1/2  veav.dvpviadGGirtggdvakalalGAdaVlvGtafly------------------------------
00380722   2/2  ----------------------------------------------------------------------
00523561   1/2  ealpdipvivdgGigtpgedaaealeaGadgvvvGsaifkaedpaea-----------------------
00416581   1/2  evvkdkipviaaGGIrtgeDalkalaaGad..riG-----------------------------------
00514891   1/2  aavkkav.sipviavggitspedaeealeeggadlvalgRallanPdlvlkiaegleleildcit-----
00491462   2/2  ----------------------------------------------------------------------
00501322   2/2  ----------------------------------------------------------------------
00482942   2/2  ------------------------------------------------------------------vile
00366281   1/2  ellgdvplivdgGirtpgdaaealeagadgvvvGraitkae-----------------------------
00364572   2/2  ----------------------------------------------------------------------
00500032   2/2  ----------------------------------------------------------------------
00394822   2/2  ----------------------------------------------------------------------
00480291   1/2  vaealgelglrgripviadGGirtgedaakalalGAdaVmvGraflgapeaggpegvknllealleelrl
00500031   1/2  lsgaalkplalrlvaevreavggdipiigvGGIrtgedalealaaGAsaV--------------------
00499221   1/2  krvkkat.dlpvivGfGIstpenakell..gAdgvvVGsaivkliennldl-------------------
00499222   2/2  ----------------------------------------------------------------------
00426111   1/2  asilvgegyflelaeaireav.kipviavggi.tpelaeealeegladlval------------------
00472422   2/2  ----------------------------------------------------------------------
00411522   2/2  -------------------------------------------------------------------ilg
00364571   1/2  gydldlakavkeavk.ipviavggittpedaeealeaggadlvavgraflanP-----------------
00480292   2/2  ----------------------------------------------------------------------
00495871   1/2  aeavggdipviadGGirtggDvakalalGAdaVmiGrafly-----------------------------
00501352   2/2  ----------------------------------------------------------------------
00366282   2/2  ----------------------------------------------------------------------
00482941   1/2  eavggldvgvkaaGGirtledalkllaaGad..riGtssl------------------------------
00502461   1/2  gplpdipivatGGisl.dnaaeylaaGavavavgsalf--------------------------------
00496752   2/2  ----------------------------------------------------------------------
00523562   2/2  -----------------------------------------------------plivalDfadleealel
00421101   1/2  cttrlvagvglp.tltallevaeavggipviadGGirtggdvakalalGAdaVgiGraflyaleapgeeg
00421102   2/2  ----------------------------------------------------------------------
00495872   2/2  ----------------------------------------------------------------------
00514892   2/2  ----------------------------------------------------------------------
00502462   2/2  ----------------------------------------------------------------------
00490042   2/2  ----------------------------------------------------------------------
00426112   2/2  ----------------------------------------------------------------------
00501321   1/2  ellddvlviaesGisspedvllllel.adavlvGe.aLmraddpgealrellg-----------------


                         +         -         -         -         -         *         -:210
query           WSKLSRHNLIDIAQRFEKDGVEAIIYTDIQRDGMMKGVNIEATSELAKAINIPVIASGGVSSLTEIEALC
00489981   1/1  wleltgvdavelakrleelgadeilvtsidrdgtlsgpdlellkklaeavsipviasGGigsledlkell
00496291   1/1  dglvatrggleltgvdlvelakaaeeaGadailvtsidrdgtlsgpdlellkevaeavsipviasGGigs
00503221   1/1  dgwle.sgldavelakkaeeaGadaiiltgidrdgtlggpdlellrevaeavdipviasGGigsledlaa
00471251   1/1  laevatkgglevtpidavelakraeelgadailltsrtvtgtlsgpdlellkevaeavsipviasGGigt
00397811   1/1  tnpdeahgyllsqfllpllaelakeygaqaivvgidakrgkggaallddpelveaiveavkeavpvpvtv
00399921   1/1  gvpvtvkirggldltdvdavelakaleeagadailvtgglgggtlggadlelvaeiaeavgiPviasGGi
00496611   1/1  lglyygsdkeaeqaledlervrelcralglplvvelvarggrl...gwakvdpeliadaareaaelGa.d
00457121   1/1  lsdpelvellelakelglevlvevht..................leeakralelgadligvnnr..dgtt
00502011   1/1  npgtglvaikgvapttdidalelamtvepggagqvlltgv..tGtls..diellkalreavgipvviagG
00497391   1/1  kvlvtgvdtlelakrledaGadailvtg.gpggtglgvadlellrevaeavdiPviadGGIgtpedaaka
00515981   1/1  kealraarlgrealrtkgikllpdvvttveaaraaeeaGadvigvtggdltgtkrlagaglelvrevkea
00514421   1/1  glivlv................gvltlee.akaaeeaGadaigvsnigltgtvagvgppdlellrevve.
00465991   1/1  ireldaedarllleagadavelnigcpntpvlgallakdpelvaivvaavkkavkvpvvvkivpgvddlv
00526101   1/1  eaggfayvvlnpgtsvagvtgarpvlglvdlvlaaavae.glsglliiyleadgt..pvdlelvkevkka
00511641   1/1  .....kaltlgllvladvatveeAkraeeaGadaigvgvhggtdvtkdgglggpdlellkevveavdipv
00450461   1/1  .........leealeaeelgadyillgpvfptgtkpgfgplglellrelveavkipviasGGi.tpenaa
00497211   1/1  lgaagglgvtfhraldaald..............aeealedlielGvvrilt.....sGgaagaleglel
00385831   1/1  lvkaalklglevivcvget...............leleealrleevgiayepvwaigtgggatnrnleqi
00478891   1/1  vlvlpv.............tsleeakaalelgadyvlvglvvgtggdgvvfgpaglellrelreldipvi
00384291   1/2  eeala-----------------------------------------------------------------
00380721   1/2  ----------------------------------------------------------------------
00384292   2/2  -------davelakaleeaGadylhvsdgdgag.geganlelieaireavgipviasGgi.tpedaeeal
00487681   1/1  ...........leeleralalgadiigvnnrgltgle..vdldtllellklvpedipvvaegGIstpedv
00471011   1/1  ..........lklgvslnpstplerlkellklllgvdyvllmsvlpgftgqkfipaslekikelrkligd
00362582   2/2  ---ltgvdtvelakraeeaGadavvvsnttggrgldgttrrvaeagglsGaplkpaslellreiaeavgg
00449282   2/2  ---------vlearralalgadaiayepveaigtgkganpellpevveavrallelapdvpviagGGigt
00447601   1/2  ----------------------------------------------------------------------
00471402   2/2  d......dtvelaraaeeaGadgiivhnrtgtqlidvearkallglglgsinetgglsgpaippaaleli
00449281   1/2  ----------------------------------------------------------------------
00518992   2/2  ---idtaedveiakaleeaGladaiivsnrtggtlaadigpgsllttrlvehgglsgdalpplalellae
00394821   1/2  ----------------------------------------------------------------------
00491461   1/2  ----------------------------------------------------------------------
00492281   1/1  likaikklgkkvgvaln.........patplealeaile....gadyvlvgsvnpgftgqkfipgv.lek
00497082   2/2  ---lsvedieeiakaleeaGadgiivsnttagghgrtslegvtgglsglpllpasleliaalrealggri
00416931   1/1  vganstreaielaklaeelGadailvlppyydkpsqegllahfkavaeavdlPvilYniPgrtgvdlspe
00527141   1/1  igvaln...........pstplerlkaildladyvlvmsvlpgftgqkfipss..lekikalrkligelg
00467212   2/2  ---ldvediedlakaleeaGadaiivsngigggtgltplelagvhgglsglplapaslevlaelreavgg
00497081   1/2  ----------------------------------------------------------------------
00467211   1/2  ----------------------------------------------------------------------
00471401   1/2  ----------------------------------------------------------------------
00524812   2/2  ------ediediakalveaGadaivvsntthggrqldiegvdlivaqgpeagglsGnalapaaleliaei
00447602   2/2  -------dtvelakaleeaGadaltvhgrtrsqrytgpadleaikevke..sipvianGgirtpedaaka
00362581   1/2  ----------------------------------------------------------------------
00518991   1/2  ----------------------------------------------------------------------
00524811   1/2  ----------------------------------------------------------------------
00424452   2/2  ---ltleeavelakaleeaGadyihvsggtleglvplestpvpggadlelaravreavsipviavggirt
00476511   1/1  ...wtleeairlakaleeagygllwi.......EePlpaddleglaelreavgipiaadEsvtsledlke
00416582   2/2  tgdldleeiveaakaaaeaGadfiktstGfggggatlealrlilevvkd.kipviaaGGIrtgeDalkal
00411521   1/2  ----------------------------------------------------------------------
00498482   2/2  ---ltveeiveaaraaveaGadfiktstgggsg...gatlevlaliveavggkipviaaGGirtaedalk
00498481   1/2  ----------------------------------------------------------------------
00470262   2/2  ---------vedaraaaeaGadaivvsggggggldvgvptlealpevaeavggdipviadGGIrtgedva
00496741   1/1  glkvgvaln...............pstplealkalldl.adyvlvmsvnpgfggqkfipasleklkelrk
00470261   1/2  ----------------------------------------------------------------------
00501351   1/2  llealleelr------------------------------------------------------------
00490041   1/2  ----------------------------------------------------------------------
00507172   2/2  ------gddlelakrleeagadavmplgeligsgiglanpellraiaeavkvPVivdGGIgtpsdaaaam
00507171   1/2  ----------------------------------------------------------------------
00424451   1/2  ----------------------------------------------------------------------
00496751   1/2  ----------------------------------------------------------------------
00383081   1/2  ----------------------------------------------------------------------
00383082   2/2  ldsltleealelakaleeagvdylhvsggtvegvpegafldlaaavrkavkipviavggi.dpelaeea.
00472421   1/2  ----------------------------------------------------------------------
00380722   2/2  ------ttpverlkevaelgagfiylvsltgvtg.grkalpetllelirrireavdvpvivggGistped
00523561   1/2  ----------------------------------------------------------------------
00416581   1/2  ----------------------------------------------------------------------
00514891   1/2  ----------------------------------------------------------------------
00491462   2/2  ---------lerlkaiaklgdgflymvvipGvtGqktgfipevlelvkevkkatdipvivggGIstpeda
00501322   2/2  ------------------------------rnlttlevdlnttlellelipellddvlviaesGissped
00482942   2/2  tglltleeiakaallaaeaGadfiktst....GfllggatledvllmleavggldvgvkaaGGirtleda
00366281   1/2  ----------------------------------------------------------------------
00364572   2/2  ---ltledavelakaleeagldylhvsggtreglvlliatlilvrggydldlakavkeavkipviavggi
00500032   2/2  ---lteediaeiaraaeeagadgiivtNttggrlldlepllgveagglsgaalkplalrlvaevreavgg
00394822   2/2  ------eflveaaraaaeaGAdfikvsd....GgtvggatpeavallvealrevavgvkipvhasGGirt
00480291   1/2  imallGvrs-------------------------------------------------------------
00500031   1/2  ----------------------------------------------------------------------
00499221   1/2  ----------------------------------------------------------------------
00499222   2/2  ---------lerlkaiaelgsgfiylvsllgvTGaktgvspdllellkrvkkatdlpvivGfGIstpena
00426111   1/2  ----------------------------------------------------------------------
00472422   2/2  ----------edarraleaGadaivvsghggggldvgiptlaalpevveavdvpviadGGirtggdvaka
00411522   2/2  tvlldeeeivelaealieaGaDgikvsgGfggigatlealrliaevvke.kipiiadGGIrsgedalkal
00364571   1/2  ----------------------------------------------------------------------
00480292   2/2  ---------vedAkaaeeaGaDaivvsg.aGGtgldvgpptlealaevaealgelglrgripviadGGir
00495871   1/2  ----------------------------------------------------------------------
00501352   2/2  ----------edaralleaGadaivvsgggggghidvetlravgaattggllgvgvptlallaevrealg
00366282   2/2  --------------------------------------nlellkeirellgdvplivdgGirtpgdaaea
00482941   1/2  ----------------------------------------------------------------------
00502461   1/2  ----------------------------------------------------------------------
00496752   2/2  ---------------------------------------lekikelrkligdipiivdGGin.petikka
00523562   2/2  adalaphvdvikvgfvlflafgpevvkalrkktgvpvildlklmdigntvadyaeaaaeagadgvtvhae
00421101   1/2  vvnvlellle------------------------------------------------------------
00421102   2/2  ----------edalllaeaGadaivvsghgGrqldavevarsicttrlvagvglptltallevaea----
00495872   2/2  ----------edallaaeaGadaivvsghggggldvgvptlealpevaeavggdipviadGGirtggDva
00514892   2/2  --------avelakaleeagvdllhvshgrtsglstpaipgafldlaaavkkavsipviavggitspeda
00502462   2/2  ------------alaalelgadyvklfpaep......ggpeylkalrgplpdipivatGGisl....dna
00490042   2/2  ----------------------------------------ellerireltdlpvlvgfGistpeqvkaal
00426112   2/2  ---ltleealelakaleeagldylhvsegrveglvlliasilvgegyflelaeaireavkipviavggi.
00501321   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QHEQDGIGGAIIGRALYEEKIQLAEALAIAKRLSGESTA-------------------------------
00489981   1/1  elsnlletgadgvlvgsallggpltleeake---------------------------------------
00496291   1/1  ledaaellaa...GadavlvGsallggplllke-------------------------------------
00503221   1/1  alellalGadgvlvGsallggpeslaeakey---------------------------------------
00471251   1/1  pedaakllea...GadgvivGsalfggplileeakalle-------------------------------
00397811   1/1  kirggtelgdidavelakaleeaGadail-----------------------------------------
00399921   1/1  rspedaakala...aGAdaVlvgsal--------------------------------------------
00496611   1/1  ilkvevptdagtlegpnlealrevveavgiP---------------------------------------
00457121   1/1  ggvdlellkelaeavpkdipviasGGis------------------------------------------
00502011   1/1  Gistpedaaelle....gAdgvvvGsaifkged-------------------------------------
00497391   1/1  lel...GAdgVlvGsaiagaedPgemaral----------------------------------------
00515981   1/1  vpipvinfaaGGIgtpedaaaalel...GAd---------------------------------------
00514421   1/1  vgipviadGGIrtpedaakala...aGAdgv---------------------------------------
00465991   1/1  eiakaleeaGadaiivtnttagghlg--------------------------------------------
00526101   1/1  vpdipvivgGGIsspedakelle....gA-----------------------------------------
00511641   1/1  iaeGgIntpedakkala...lGadavmvGsa---------------------------------------
00450461   1/1  ealea...Gadgvavgsailgapdpaeaakall-------------------------------------
00497211   1/1  lkelvelagripivagGGit--------------------------------------------------
00385831   1/1  eelleairellgdvpviagGGistpndaalale-------------------------------------
00478891   1/1  vdGGi.tpedaaealea...GadgvvvGsaitkaedp---------------------------------
00384291   1/2  ----------------------------------------------------------------------
00380721   1/2  ----------------------------------------------------------------------
00384292   2/2  aa...gladlValGrallanpdlvakla------------------------------------------
00487681   1/1  akl....aagadgvlvGsalmraddpgeavr---------------------------------------
00471011   1/1  ipiivdGGI.npetikeaiea...GadgvvvGsaitka--------------------------------
00362582   2/2  dipviadGGIrtgedaa-----------------------------------------------------
00449282   2/2  gndaaaalal...GadgVlvGsallka-------------------------------------------
00447601   1/2  ----------------------------------------------------------------------
00471402   2/2  aevreavpgipvianGGI----------------------------------------------------
00449281   1/2  ----------------------------------------------------------------------
00518992   2/2  vaeavgdipviadGGIrsgedaakala-------------------------------------------
00394821   1/2  ----------------------------------------------------------------------
00491461   1/2  ----------------------------------------------------------------------
00492281   1/1  lkalrkligelgldipiivdGGI.npenikkaiea...--------------------------------
00497082   2/2  pviavGGIrtgedaakala...aGAdg-------------------------------------------
00416931   1/1  tlarlaeeipnivgiKdasgdlgrlerllrlle-------------------------------------
00527141   1/1  ldipivvdGGi.npetikkaiea...GadgvvvGs-----------------------------------
00467212   2/2  ripviadGGirsgedaakala...lGAdaV----------------------------------------
00497081   1/2  ----------------------------------------------------------------------
00467211   1/2  ----------------------------------------------------------------------
00471401   1/2  ----------------------------------------------------------------------
00524812   2/2  adavkgdipviadGGIrsgedaakala...lGA-------------------------------------
00447602   2/2  lea..tGadgVmigraalgnpelfgeikeg----------------------------------------
00362581   1/2  ----------------------------------------------------------------------
00518991   1/2  ----------------------------------------------------------------------
00524811   1/2  ----------------------------------------------------------------------
00424452   2/2  pedaeeale..aggadl-----------------------------------------------------
00476511   1/1  ll..eagaadavqiklakiGgltealkiaalAe-------------------------------------
00416582   2/2  aaGadriGtssllallaglelgvv----------------------------------------------
00411521   1/2  ----------------------------------------------------------------------
00498482   2/2  alaa...GAdavgvgs------------------------------------------------------
00498481   1/2  ----------------------------------------------------------------------
00470262   2/2  kalal...GAdgVlvGta----------------------------------------------------
00496741   1/1  ligelgldipivvdGGi.npenikkalea...Gadg----------------------------------
00470261   1/2  ----------------------------------------------------------------------
00501351   1/2  ----------------------------------------------------------------------
00490041   1/2  ----------------------------------------------------------------------
00507172   2/2  el...GadgVlvgtaiakakdpvlmaralv----------------------------------------
00507171   1/2  ----------------------------------------------------------------------
00424451   1/2  ----------------------------------------------------------------------
00496751   1/2  ----------------------------------------------------------------------
00383081   1/2  ----------------------------------------------------------------------
00383082   2/2  .leeggaDlvaigRafl-----------------------------------------------------
00472421   1/2  ----------------------------------------------------------------------
00380722   2/2  vaellea...GAdgvvvGsaivkllaedpeeaikellel-------------------------------
00523561   1/2  ----------------------------------------------------------------------
00416581   1/2  ----------------------------------------------------------------------
00514891   1/2  ----------------------------------------------------------------------
00491462   2/2  kealea...GAdgvvvGsaivkaidgalaieel-------------------------------------
00501322   2/2  vllllel....adavlvGeaLmraddpgeal---------------------------------------
00482942   2/2  lkllaaGad.....riGtsslleilael------------------------------------------
00366281   1/2  ----------------------------------------------------------------------
00364572   2/2  ttpedaeealeaggadlvavgraflan-------------------------------------------
00500032   2/2  dipiigvGGIrtgedalealaa...---------------------------------------------
00394822   2/2  dedaakalalaaveaGadqvgad-----------------------------------------------
00480291   1/2  ----------------------------------------------------------------------
00500031   1/2  ----------------------------------------------------------------------
00499221   1/2  ----------------------------------------------------------------------
00499222   2/2  kell.....gAdgvvVGsaivkliennldleevlkf----------------------------------
00426111   1/2  ----------------------------------------------------------------------
00472422   2/2  l...alGAdaVlvGtaf-----------------------------------------------------
00411522   2/2  aaGAdlv.gvgsalaileellglleelggssi--------------------------------------
00364571   1/2  ----------------------------------------------------------------------
00480292   2/2  tgedaakala...lGAdaVmvGraflgapeaggpegvk--------------------------------
00495871   1/2  ----------------------------------------------------------------------
00501352   2/2  dipviadGGirtgedaa-----------------------------------------------------
00366282   2/2  lea....gadgvvvGraitkaedpaeaaeaire-------------------------------------
00482941   1/2  ----------------------------------------------------------------------
00502461   1/2  ----------------------------------------------------------------------
00496752   2/2  iea...GadivvvGsaifkae.dpeeaikalrkalke---------------------------------
00523562   2/2  agpdtleallglkllilvtvltseealealllga------------------------------------
00421101   1/2  ----------------------------------------------------------------------
00421102   2/2  ----------------------------------------------------------------------
00495872   2/2  kalal...GAdaVmiGra----------------------------------------------------
00514892   2/2  eeal..eeggadlvalg-----------------------------------------------------
00502462   2/2  aeylaaGavavavgsalfkkdliaagdweaitelarel--------------------------------
00490042   2/2  ea...GAdgvvvGSaivk----------------------------------------------------
00426112   2/2  tpelaeeale------------------------------------------------------------
00501321   1/2  ----------------------------------------------------------------------