[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA59517.1


[Show Plain Result]

## Summary of Sequence Search
   1::515
  97::384 4.5e-102 48.5% 0046478 00464781 1/1   p containing nucleoside triphosphate hy 
  98::384  4.4e-94 48.6% 0043648 00436481 1/1   p containing nucleoside triphosphate hy 
  98::384  1.1e-91 46.4% 0037818 00378181 1/1   p containing nucleoside triphosphate hy 
  97::379  9.2e-62 36.2% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
  97::382  3.6e-54 32.0% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
 113::429  5.5e-54 28.8% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
 385::515  9.8e-48 52.7% 0036812 00368121 1/1   minal domain of alpha and beta subunits 
 385::517    1e-46 53.4% 0043646 00436461 1/1   minal domain of alpha and beta subunits 
 110::394  2.1e-46 29.7% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
 385::513    3e-46 54.3% 0037816 00378161 1/1   minal domain of alpha and beta subunits 
  97::378  8.1e-46 31.2% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
 110::379    7e-43 30.9% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
 110::395  4.7e-41 29.9% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
  11::96   1.6e-30 52.3% 0040863 00408631 1/1   minal domain of alpha and beta subunits 
  26::97   5.7e-23 54.2% 0037817 00378171 1/1   minal domain of alpha and beta subunits 
  23::97   3.8e-22 50.7% 0043647 00436471 1/1   minal domain of alpha and beta subunits 
 146::405  4.9e-07 22.4% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
 143::199  2.1e-05 28.6% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
 129::263  0.00027 15.8% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
   1::515


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLER
00464781   1/1  ----------------------------------------------------------------------
00436481   1/1  ----------------------------------------------------------------------
00378181   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00368121   1/1  ----------------------------------------------------------------------
00436461   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00378161   1/1  ----------------------------------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00408631   1/1  ----------lelikerienldleleleevGtvlsvgdGiarvyGlenvmagellefeggvlGlalnlee
00378171   1/1  -------------------------eleevGtvlsvgdGiarvyGlenvllgellefeggvlGlalnlee
00436471   1/1  ----------------------leleleevGtvlsvgdgiarveglenvmagelvefengllGlalnlee
00496111   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVIT
00464781   1/1  --------------------------lkvpvgdallgrvvdvlgepidgkgpllalerlpveltapnple
00436481   1/1  ---------------------------svpvgdallGrvldvlgepidgkgpilaeerlpierlaplile
00378181   1/1  ---------------------------evpvgdallGrvldvlgepidgkgpllllllrpinrlapnile
00464791   1/1  --------------------------lsvpvgdkllGrvldvlgepidglgpllalerlpierlapplle
00468691   1/1  --------------------------lsvpvglallgrvldvlgepidglgplllllllpivrlapplle
00424961   1/1  ------------------------------------------lgepldglgplr.........papglle
00368121   1/1  ----------------------------------------------------------------------
00436461   1/1  ----------------------------------------------------------------------
00510561   1/1  ---------------------------------------ldglgepldgllpilaklfrpievlalglle
00378161   1/1  ----------------------------------------------------------------------
00436511   1/1  --------------------------ievpvglallgrvldllgepidgkgplelgepllevenlsksyg
00498531   1/1  ---------------------------------------ldklgkildlalkileksflklevlalgvle
00468951   1/1  ---------------------------------------lnvlgesidalgkilseilkllekgfltalg
00408631   1/1  dnvgvvllgddlsikeGdlvkrtgri--------------------------------------------
00378171   1/1  dnvgvvllgddesikeGdlvkrtgril-------------------------------------------
00436471   1/1  dnvgvvvlgdtsgikeGdlvkrtgkil-------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------pgllsllellle


                         +         -         -         -         -         *         -:210
query           RQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIKCIYVAIGQKASSVAGV
00464781   1/1  rllleeplltgirviDlllpigrGqrilifggsgvGKtvlalqlianqaklnessdedadvlvvyvliGe
00436481   1/1  rrlvleplstGiralDlllpigrGqrilifGppgtGKTtlalqiianaaknggvvvyvligerlrevtel
00378181   1/1  rrvvveplstgirviDlllpigrGqrilifGpsgtGKTtlalqiianaqkeggvvvyvligergrevtef
00464791   1/1  lenlskrfgtgivlidvslpigkGervglvGpnGaGKTtLlkllagllkpdsgeivvygligerprevre
00468691   1/1  lenlsksygtgialidvsltigrGervglvGpnGaGKttL.lkllagllkpdsgeilvd.Gedlr...el
00424961   1/1  lenvsksygtgialidlslpigkGervalvGpsGaGKttL.lrliaglldpdsgeilldgvdigersrev
00368121   1/1  ----------------------------------------------------------------------
00436461   1/1  ----------------------------------------------------------------------
00510561   1/1  rksv.erlstGikaLDlllgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql
00378161   1/1  ----------------------------------------------------------------------
00436511   1/1  grklvlepletgialddvsltikkGervglvGpsGaGKtTL.lkllagllkpdsGeilvdgligerlrev
00498531   1/1  rkev.erlstGikaLDallgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql
00468951   1/1  llerksv.erlstgikaLDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyidteesl
00408631   1/1  ----------------------------------------------------------------------
00378171   1/1  ----------------------------------------------------------------------
00436471   1/1  ----------------------------------------------------------------------
00496111   1/1  -----elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliiglel
00482551   1/1  --ev.erlstgipalDellgGglppgslvliaGppGsGKTtlalqlaanaalplelgkl-----------
00500611   1/1  lenl.tklptgipaLddvlgggipkGeivllvGpsGsGKTtlllqlagllapdsgeillggkvlyislee


                         -         -         -         +         -         -         -:280
query           VRKLEEHGALEHTIVVAASASESAALQFIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLR
00464781   1/1  rgrevtefleelkgegalertvvvastadepallrllvaytaltiAeyfrdqgkdVllllDsltrlaeAl
00436481   1/1  leeleelgalkrtvvvaatadepalarllaaetaltiaeylrdsgkdvllvlDsltrlalalreislalg
00378181   1/1  aeelldlgalkrtvvvaatadepallrllaaetaltiaeylrdsgkdvllvldsltrlalalrevslalg
00464791   1/1  llglllelgvlfaaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvllllDEptsgldal
00468691   1/1  relrrrigyvfqdpalfpeltvlenlalgallaglglaeyldelgkdLSgGqrqrvalArpvlLllDEpt
00424961   1/1  telleel.......rrviglvfqdpplfprltvaenialgaeyfrdegadvllladsllrlagalrevlg
00368121   1/1  ----------------------------------------------------------------------
00436461   1/1  ----------------------------------------------------------------------
00510561   1/1  ..rarrlgld............ldrlllldaltveellalaerllsggkvdlvviDsltalapal.elsl
00378161   1/1  ----------------------------------------------------------------------
00436511   1/1  lelirelelaelrrrigyvfqdpalpallrllalfpaltvaenlrfglglavlllldsatrlaqakreis
00498531   1/1  ..rarrlgld............ldellllpaltveellalaerllsggkpdlvviDsltala.....psl
00468951   1/1  dqlr..arrlgld............lddllllpaltveellalaerllsggkpqlvviDslt....alrp
00408631   1/1  ----------------------------------------------------------------------
00378171   1/1  ----------------------------------------------------------------------
00436471   1/1  ----------------------------------------------------------------------
00496111   1/1  saeelrerrrrigyvfqepalfpeltvlenlalglldrlpgeldlSgglqrqrvaiaagdpdllllDept
00482551   1/1  ----------------------------------------------------------------------
00500611   1/1  .slrrrrigmvfqelgldpdltvarerviellelvgllelldrlprelkrsgg-----------------


                         -         *         -         -         -         -         +:350
query           RPPGREAFPGDVFYLHSRLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISI
00464781   1/1  revslllgepPgregyppdlfsllsrlleragn.........legllgg..GsiTalptvlvpgddlsdp
00436481   1/1  elpgregypptlfillsrlleragvvr.....giteg......gsiTalptvlvegddlsdpipdnvisi
00378181   1/1  elpgregypgtlfsllsrlleragvvrgilgg...........gsiTalptvlvegddlsdpipdntlsi
00464791   1/1  reillllgellseegytvllvshdlslleraadr...............eggsitalgtvlveggdlsdp
00468691   1/1  sgldalreilellrellkelgytvllvthdlsladrilvl...............edGsitalgtveell
00424961   1/1  rlgrelS.gGqkqrvaiarallleragnle..............ggGsiTalatvlveggsdpdllllDe
00368121   1/1  ----------------------------------------------------------------------
00436461   1/1  ----------------------------------------------------------------------
00510561   1/1  lldepts..gldasllreilrllkrlakelgvtvllvshvlkeve...........dladpvpdlrgggv
00378161   1/1  ----------------------------------------------------------------------
00436511   1/1  alarellervglpgdlftllsrlderagnlS...............gGqrqrvaiaralasdpdllilDE
00498531   1/1  llldepgrvtqgldarllreilrllkrlak.................elgitvlltshvtrevedraddv
00468951   1/1  .alllldeptgellgldvrll.sellrllkrlakel...........gvtvilvshvlkegedraddvpd
00408631   1/1  ----------------------------------------------------------------------
00378171   1/1  ----------------------------------------------------------------------
00436471   1/1  ----------------------------------------------------------------------
00496111   1/1  salrslgndpelraellrllkrl..kelgvtvilvthdleeae...........................
00482551   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           TDGQIFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR
00464781   1/1  ipdntlsildgqivLsrklaekgiyPAidvllSv------------------------------------
00436481   1/1  ldgqivLsrdlaekgiyPAIdvllSvSrlldlll------------------------------------
00378181   1/1  ldgqivLsrklaekgiyPAidvllSvSrlldlll------------------------------------
00464791   1/1  ivelllsildgvivldrdlaekgiyPaid-----------------------------------------
00468691   1/1  ddlgdpitllllsildgqivlsrelaekgiyP--------------------------------------
00424961   1/1  ptsalDgeivlslllalkrlyPaidvllSvsrvldllllkeilqaakgltvilvthdlsealadrilvld
00368121   1/1  ----------------------------------ikamkkvaGslklelAqyreleafaqfgsdldeatk
00436461   1/1  ----------------------------------ikamkkvaGslklelAqyreleafaqFgsdldeatk
00510561   1/1  lehiadvvlllerdeiylkdgldlvggrrelrvvKnrvgpvgsv--------------------------
00378161   1/1  ----------------------------------ikamkkvaGslklelAqyreleafaqfgsdldeatk
00436511   1/1  ptsglDpetvllralaeggtvllishdl------------------------------------------
00498531   1/1  pvlagggvlehladvvlflerdeaykgir-----------------------------------------
00468951   1/1  lagggvleqiadvviflerdeaykgilpaigglrelrvvKnrfgp-------------------------
00408631   1/1  ----------------------------------------------------------------------
00378171   1/1  ----------------------------------------------------------------------
00436471   1/1  ----------------------------------------------------------------------
00496111   1/1  ............dladsgriavladgrivlegdlaelglrralivlksrlgplgt---------------
00482551   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDKITK
00464781   1/1  ----------------------------------------------------------------------
00436481   1/1  ----------------------------------------------------------------------
00378181   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00424961   1/1  dgkiveegt-------------------------------------------------------------
00368121   1/1  aqLerGerltellkQkqysPlsveeqvvilyaltngllddipvekilkfekelleylksnhadlleaiee
00436461   1/1  aqLerGerltelLkQkqysPlsveeqvvilyaltngllddipvekilkfekelleylksnladlleliee
00510561   1/1  ----------------------------------------------------------------------
00378161   1/1  aqLerGerltellkQkqysPlsveeqvvilyaltngllddipvekilkfekelleylksnhaelleliee
00436511   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00408631   1/1  ----------------------------------------------------------------------
00378171   1/1  ----------------------------------------------------------------------
00436471   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           TGDYSDEIAAELRAAIENFKTTNTW---------------------------------------------
00464781   1/1  ----------------------------------------------------------------------
00436481   1/1  ----------------------------------------------------------------------
00378181   1/1  ----------------------------------------------------------------------
00464791   1/1  ----------------------------------------------------------------------
00468691   1/1  ----------------------------------------------------------------------
00424961   1/1  ----------------------------------------------------------------------
00368121   1/1  tkklddeleallkeaieeflksfql---------------------------------------------
00436461   1/1  tkdldde..ellkeaieefkktfllsl-------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00378161   1/1  tkklddeleellkeaieeflktf-----------------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00408631   1/1  ----------------------------------------------------------------------
00378171   1/1  ----------------------------------------------------------------------
00436471   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------