[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA59518.1


[Show Plain Result]

## Summary of Sequence Search
   1::178
   2::107  8.3e-23 35.2% 0034989 00349891 1/1   minal domain of the delta subunit of th 
   1::178


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAEKITIARPYANAVFELAQAQKNYDQWSRVLNVFADLARDSEMQILIDDPRYTSEQLIGLFVEIGGDTV
00349891   1/1  -velstvarrYAkALfelAleknsldevledlelllevlkdpklkellsnplisaeekkellkallg.gl


                         -         -         *         -         -         -         -:140
query           TESAKNFIKILADNRRLSVLPEVAALFEQLRAEIEGTLEVEIISAKPLAEEQLNEIASALKRRLGREVTF
00349891   1/1  selllnfLkllaengRllllpeileeflellaelegi---------------------------------


                         +         -         -         -         -         *         -:210
query           SRKTDESLLGGVIIRAGDLVIDGSAIGKLNQLAASLLH--------------------------------
00349891   1/1  ----------------------------------------------------------------------