[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL62792.1


[Show Plain Result]

## Summary of Sequence Search
   1::394
   4::110  PF00535 0.0% 38.3177570093458  Glycosyl transferase family 2 
   1::394


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MCITVVLPTLNEAQALPKVVEELRATGYRDILVVDGGSTDGTVEEAKRLGLRVIGQYGRGKGMALRTALM
PF00535         ---sviiptyNeekylletlesllaqtyenfeiivvDDgStDetkeileeyaksdlrvrvirleknvGka


                         -         -         *         -         -         -         -:140
query           YVETPYVAVLDADYTYPPAELNKLVPLLRHYDVVIGARQGKMPALYKLGNKVLAWLFRVLFGVDLRDPLT
PF00535         garnaglkkakgdyilflDaDdepdpdwleklveklekdg------------------------------


                         +         -         -         -         -         *         -:210
query           GMYVARTDVLREAVTEARGFDLEVEILAKALANGARVAEVPIQYRERIGKKKLRPWHGVGIAVKALELAY
PF00535         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RLNPALFLTLIGALMLIPAVALGGWVAYRYFYQGVPHYMLGLAALLMLVIGGISTALLPLHTTIQQLRAS
PF00535         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IRRALIPPAPTDCLSPLPQPPPPAPPQRPAPEKATVLERAAQGLITAFIVLLAAAAYYLGIGDAATANKL
PF00535         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AEWAYYALAGGVLATLIDTAIAQRRQKQLQRQAFRTSHSAVITS--------------------------
PF00535         ----------------------------------------------------------------------