[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL62997.1


[Show Plain Result]

## Summary of Sequence Search
   1::379
  39::62   PF01189 0.0% 25  NOL1/NOP2/sun family 
 168::373  PF01189 0.0% 29.2682926829268  NOL1/NOP2/sun family 
  90::160  PF01472 0.0% 42.2535211267606  PUA domain 
   1::379


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNLYGIEIDDLLYKHFLEFLSDAEIDSLFRSITTPPPRYYIRVNTLKISPRELVKRLNSRGLAVYRDEYI
PF01189         --------------------------------------gtlRknvlktkreslaaalelaav--------
PF01189         --------------------------------------gtlRknvlktkreslaaalelaav--------
PF01472         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DDALWVPVEGPFKIPTAKKVVVVDKKAAESVMLGADLYAPAVIKTDRVNIGDEVNIVSDNGRVVALGVAV
PF01189         ----------------------------------------------------------------------
PF01189         ----------------------------------------------------------------------
PF01472         -------------------rvvvddgAvkavlsgasLlapGVievegdfregdeVvivtedgelvavGla


                         +         -         -         -         -         *         -:210
query           MDSDEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGK
PF01189         ---------------------------gsLpefengavvvqdassqldaiaLapqedelilDlcaapgGK
PF01189         ---------------------------gsLpefengavvvqdassqldaiaLapqedelilDlcaapgGK
PF01472         nysseelakikggksvkier--------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGV
PF01189         tthiaelmknegevvAvdrnkqrlkrvaanqqrlGvfnitvve.edatqaaqkllgsefdrilldaPcsg
PF01189         tthiaelmknegevvAvdrnkqrlkrvaanqqrlGvfnitvve.edatqaaqkllgsefdrilldaPcsg
PF01472         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWG
PF01189         tgvirrepkikwlrreadiaqlaelqkelLkaaidlvgidtkeggvlvYstCsvlveeneagiklflqkr
PF01189         tgvirrepkikwlrreadiaqlaelqkelLkaaidlvgidtkeggvlvYstCsvlveeneagiklflqkr
PF01472         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           CRECRRFLPHVHNTPGFFIAVLRGARKEP-----------------------------------------
PF01189         pdvelvltklseskealkkhriv-----------------------------------------------
PF01189         pdvelvltklseskealkkhriv-----------------------------------------------
PF01472         ----------------------------------------------------------------------