[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL63125.1


[Show Plain Result]

## Summary of Sequence Search
   1::471
  17::210  PF04055 0.0% 26.1744966442953  Radical SAM superfamily 
 361::447  PF00583 0.0% 26.6666666666667  Acetyltransferase (GNAT) family 
   1::471


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASGVHVVALMTQPFPCPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPS
PF04055         ----------------CnlrCsfCanpet................sregrgrsrsveeileevkelkeek
PF00583         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KIEAVIMGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALTVETRPD
PF04055         gvkevtltGgepllypdfvellerlakla..........................lpgirialetngtlp
PF00583         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAYKVCYHVMPGLPGSDPD
PF04055         d...eeileelaelgvdrvslglesgdeekvlklmrrghtfeevlealeklreagikrvvdfivglpget
PF00583         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RDLEMVREIFSNPSYMPDCVKIYPLYVVPNTELSEDWRRGLYKSYDEETWLELLAKIYASIPRWVRVMRF
PF04055         ----------------------------------------------------------------------
PF00583         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GRDIPLHHVLDGPRWGNMRQIVLKHMERLGLKCQEIRCREVGIKLANNVPIQPGPVEVKKTEYEASGGLE
PF04055         ----------------------------------------------------------------------
PF00583         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           IFLEAVGPDDTLYAILRLRIPNRPHRPELYKAALVRELHVYGPAVPVGKQGIWWQHSGMGRELMRLAEEI
PF04055         ----------------------------------------------------------------------
PF00583         ----------elvGfaslsvigedgra.......ertayieglaVs.....peyrgqGiGkaLleallek


                         -         -         +         -         -         -         -:490
query           AGEFGALKIAVISGVGVREYYRKLGYERCGPYMCKPLGAPLGVADDGLVAG-------------------
PF04055         ----------------------------------------------------------------------
PF00583         arerglerielevesgndraiklYekl-------------------------------------------