[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL63374.1


[Show Plain Result]

## Summary of Sequence Search
   1::327
   2::134  PF01565 0.0% 30.3030303030303  FAD binding domain 
 298::325  PF02913 0.0% 42.8571428571429  FAD linked oxidases, C-terminal domain 
   1::327


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRPKSVEELVELMKEANRDRRRLLPICKGSKAHLGPPVEYDEELQLWDMPKVLEVDEEEMVVRTSACISA
PF01565         -rpeseeevaaivrlarekglpvlvrGgGssll.gqavtggvvldlsrlnrileideeegtatveaGvtl
PF02913         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VELQEELRKRGRRLALDPPLFRRSSIGGILSTNFYGPMAYRYMTPRDQLLSVKIVTGKGEFMKFGAPVVK
PF01565         gdleealaakglllglepgslipgtvGGaiatngggygsekyGlirdnvlslevvladGevvrl------
PF02913         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DVAGYNIKRLIAGSWGTLAVLVEAYMRIYALPESVAVMATGRKSLQELRKLHVAGAAEADGVLYLRFEGV
PF01565         ----------------------------------------------------------------------
PF02913         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KSEVEYRLSKAGRGDVFYDREAEEKWSSVTEAEELFASNEIAKVVAPPASLPETPPGVKYLRYPLLGVMY
PF01565         ----------------------------------------------------------------------
PF02913         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VAGPPPAGVKAYWLKPQRKWDVENRDLMEKIKRVLDPNGVLSPGRLP-----------------------
PF01565         ----------------------------------------------------------------------
PF02913         -----------------eekgeeglalmrriKaalDPnniLNPgk-------------------------