[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL63439.1


[Show Plain Result]

## Summary of Sequence Search
   1::69
   1::66   PF00892 0.0% 34.8484848484849  EamA-like transporter family 
   1::69


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGVFGTVIPYRLFSSAVTKIEGARASVIASVEPVLAALWGFLFFKEIPGLLTLTAYALISTAAVVVARK-
PF00892         lgllgtvlgyllffyalkktsasnaslitslePvftillsvlllgekltlkqllgivlillGvlll----