[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL63598.1


[Show Plain Result]

## Summary of Sequence Search
   1::102
   1::98   PF07903 0.0% 57.2916666666667  PaRep2a protein 
   1::102


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAALKDWYRKCFRRPVVPGEEGKVVKRLELYYGMCEIAKAVMAEYGIKPDSPVIREYALRRAFRREWRGK
PF07903         leavaewyrrcfgeevl.geeekvvkrLeeyyalCqlakavkreyGgk.asvliseyaLrrafwwdgeWr


                         -         -         *         -         -         -         -:140
query           PISCFVTDLRASCNVGERRRHFACLTRPAAST--------------------------------------
PF07903         GkpvsCfvtekeavCkvGekkaeflved------------------------------------------