[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL63645.1


[Show Plain Result]

## Summary of Sequence Search
   1::641
 108::629  PF07775 0.0% 72.5490196078431  PaRep2b protein 
   1::641


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLFLPKYFHVLLPLAYAVEAYRRGELSREEAALAVIFAVLYDGTVFRDEILLFIGGPEHVESPIMTRDHF
PF07775         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TAFWLWALKELGLKPSSVYRGRGAHHIAFKGAELNGLLEAVTPALPALHELRDALTEFADAFKVVTREAV
PF07775         -------------------------------------leavepelrllfelrdalaeFadafkvvtreav


                         +         -         -         -         -         *         -:210
query           KRKFGIDWGYDVRNEMFFKKLEEVVTMAEDYVYRNVTVERWPLDTSGKQPKAVIHFKLGGEEVAYITVYW
PF07775         krkfgidraydvrneslfkKleeivtmvedyvyrnvaverelldtsgklPkvvirfkldgeevAhinvkW


                         -         -         -         +         -         -         -:280
query           TGRELQAQFGGSHENAERLASIIRALGGKAEVKRIGKVWRTWLTTDDIIAIRHDGWLNAVRGFVDELYGK
PF07775         tgkklqAkfeGsrekaerlasilrALGgevevkevgkkwvveLttdsiiaiRrdewLnAvralveeLkkk


                         -         *         -         -         -         -         +:350
query           GLIDKDKYEQLVRDLETGPNTVKFAGVEFTVNYENKIMVKYHPRNENAKNAAVNALMARGLREGVHFTVT
PF07775         gliseeryerllkeieaGPnvvklagvelsvaykkskkievkyqprseesknaavnaLkarglkEGvHft


                         -         -         -         -         *         -         -:420
query           TEGTERYEIRVTKEAFVKAIDALVHSGLEEGKHYSVYGKWRIISVKAEQKDVIVNALKAAGLKEGRDFTV
PF07775         vkkegg..yeirvtkeayakavealaqsglkegehyavydkrrvisvkaeakdavvnalkaagleegkdf


                         -         -         +         -         -         -         -:490
query           KSSRYYVVYITYDGLREIQRMASNGDMEAEKFIRELEDVLRRRHGDGAAKKLTEVLRPAREEGTVDLPLA
PF07775         avkssgqyviritydGLrelqrlalqGdkeAerfireLedvlkrRyGddavkklievlkpArEeetvdlp


                         *         -         -         -         -         +         -:560
query           VYDDRGNLIARVVDLKCEFVKGKQRSKRLASQPVSQCAGEDCRLRIIVEYELPSGERRQFKMEWYWAEKR
PF07775         laveDekgnliArvvdlkvefvk........ngqpvsqcaGedcrlrvvvEYEv.ggerkqlklewywak


                         -         -         -         *         -         -         -:630
query           EKKGDAIITYYYEIARPTVKDEVEAAVLETLTGKEAKRGRVYLYADQLDALRRFKALKDAIDKWREGKPA
PF07775         krkkkgetvvtyyyevaasvvkdeveaavlkaltg.kakrgevtLladqldaLarfkalkdavdkwree-


                         -         +         -         -         -         -         *:700
query           SSQGQGQRSDN-----------------------------------------------------------
PF07775         ----------------------------------------------------------------------