[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL63787.1


[Show Plain Result]

## Summary of Sequence Search
   1::142
   3::59   PF00571 0.0% 23.6363636363636  CBS domain 
  68::120  PF00571 0.0% 35.8490566037736  CBS domain 
   1::142


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDN
PF00571         --vgdlmtkdvvtvppdetlsealeilrktgvsrlpVvDed..grlvGiitlrDllkal--------vgd
PF00571         --vgdlmtkdvvtvppdetlsealeilrktgvsrlpVvDed..grlvGiitlrDllkal--------vgd


                         -         -         *         -         -         -         -:140
query           IMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEERIDEISA
PF00571         lmtkdvvtvppdetlsealeilrktgvsrlpVvDedgrlvGiitlrDllk--------------------
PF00571         lmtkdvvtvppdetlsealeilrktgvsrlpVvDedgrlvGiitlrDllk--------------------


                         +         -         -         -         -         *         -:210
query           HD--------------------------------------------------------------------
PF00571         ----------------------------------------------------------------------
PF00571         ----------------------------------------------------------------------