[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL63893.1


[Show Plain Result]

## Summary of Sequence Search
   1::516
   3::514  PF02538 0.0% 44.6215139442231  Hydantoinase B/oxoprolinase 
   1::516


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRWELIYRATVYIAEEAGIALRNSAFSPNIRERMDHSVAVLNASGEIVAQAEHIPVHLGSFYVGVKNLFN
PF02538         --leifkklfssiaeemgialrktaaSpnikerldfscalfdaeGdlvanathipvHlgsmgsavkelvk


                         -         -         *         -         -         -         -:140
query           ALREAGVELEEGDVVALNDPYISGTHLNDVMVVTPVFWRGRLVAYIVNKAHHVDVGGPVPGSINPSAKTI
PF02538         .nred..eledgDvlivNdpyiggtHlpDitvltPiFsseelifyvasraHhadvGgitPGSmstnskel


                         +         -         -         -         -         *         -:210
query           YEEGFVLPPVKIIKRGEVNKEALSIWLSNVKTPEATIGDLNAQIAANRVGTRRIVELFDKYGALVEEAWK
PF02538         feeGllitskllvkegelkeellekllvenvyisRipeenlaDlkaqiaanekGidsleklidevgeeev


                         -         -         -         +         -         -         -:280
query           RAIEYGRLMTQSEISKWPRGVYVAEDYLELGDKFLKIAVRLTIGECVEANYSGTDPQVDAPLNAVLGVTY
PF02538         lelikkikdnaeeavkkkiakldeiygakdieve.dkldkgklikveitinvkkeklkldFdgtsrqldh


                         -         *         -         -         -         -         +:350
query           AATSFPIRCLIRGDVPINEGFYSCISVKAPEGSLLNPKRPAAVAGGNLETSQRTADAVFKALAEAMPDKV
PF02538         nlNavkavvtsavlyvlralvaddiplNdGclrplkiiikkgsllnprkpaavvagnvetSqrisdvlyk


                         -         -         -         -         *         -         -:420
query           PAAGSGTMMNVMMGGVYQGKYWSYYETIGGGTGGRPGKHGVSGVHVNMTNTLNTPIEIAERTYPLLFTAY
PF02538         aly......veaassGtmNnvtfgqggkedgeafqyyETiggGsGagdglngadavhtnmtntrltdiEv


                         -         -         +         -         -         -         -:490
query           RIREGSGGRGKWRGGDGIVRAFKVLAPTRLAILADRFKIGPWGIQGGEAGKPGRAYVKKAGGRTIQLDSK
PF02538         lEsryPvlllefsvrkgsGGaGkyrGGnGivRevkflkdvtvsilserrrvspyGlagGkpgasGenfla


                         *         -         -         -         -         +         -:560
query           TITDLEPGDEVVIETPGGGGWGPHNF--------------------------------------------
PF02538         kktgkevelkgkaslylepgDrll----------------------------------------------