[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL64120.1


[Show Plain Result]

## Summary of Sequence Search
   1::274
  70::253  PF00881 0.0% 31.4814814814815  Nitroreductase family 
   1::274


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIRRGFLKFLFITPLGRLISGVLSAGIFSGVIFLDVIRTDVRKRTGADVEKVLLPYPRLRGVVSVEEALA
PF00881         ---------------------------------------------------------------------k


                         -         -         *         -         -         -         -:140
query           NRRSVREFREEPLTLEELGQILWAAYGISETRYGLRTAPSAGAQYPLEVYVVVGEHGVKTGDGYLKPGVY
PF00881         sRrSiRkFddepvpkedlekileaa..........rlaPsagnlqpwrfvvi.tdeelk..........e


                         +         -         -         -         -         *         -:210
query           HYDPHSHTLTLKKTGDFREALYQAALEQIWVLKAPVSLIFTAVYSRTVRVYGERGRVRYVPMDLGHAGQN
PF00881         rlaklaaealakaeaqaelllryrkkgnqklladapvlivvsrtkdk.kerksddrsyeyalldaglaaq


                         -         -         -         +         -         -         -:280
query           VYLQATALGLGTVAVGAFYDDQVAEILDLPDGETPLYIMPIGRPIYQYRLTEAELIRYIEKSRR------
PF00881         nlllaAaalGlgscpiggfdeeeevrelLglpdeeeivllial---------------------------