[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL64265.1


[Show Plain Result]

## Summary of Sequence Search
   1::360
  14::252  PF01637 0.0% 27.1111111111111  Archaeal ATPase 
   1::360


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLFRDRPAERLEELFDREEEVRRLLNAVNSSALTLILGMRRVGKTSVVKAATYGKLRIYIDARYFEEKRY
PF01637         -------------FfDRekELkeleeilerepnsiiviyGprrsGKTaLlkeileelkekgkrvvyyinl


                         -         -         *         -         -         -         -:140
query           ISYGDLLEALRKELRRLLPLHKRLGELLSKIRGVSVAGVDVKFEIGRNAPSFAEILEAFDQWAREQGERL
PF01637         reefeskleefie.eeeekkklakalgialpkaeleeilk........kksklvflaleellealkkkgk


                         +         -         -         -         -         *         -:210
query           VLIIDEAQELAKLRGRTLLPPLGYAYDNLRNISMVFTGSKAGLLLRFLRLEDPHSPLFGRYFEKIELGPF
PF01637         kiiiiiDElqklilglngakslvkeLlnlidsltkekhlcvvlclSseglfie...lvyskaplegRhky


                         -         -         -         +         -         -         -:280
query           SRELSVQFLTKGFEEAGVRVSRELIDRAVDELDGVVGWLAYFGLRAVKKPDSALEETLEYAARLAAAEFC
PF01637         .ilvkdfdketalnflregfeel.ielpgskeefeevysylG----------------------------


                         -         *         -         -         -         -         +:350
query           NFVQYMGSQRYIHVAKVCKNGARWSEVKRYLQAVEGKPITDYEVTKLLKNLVDYGFLEKRGEIYLVPDPV
PF01637         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LRTALQSLRC------------------------------------------------------------
PF01637         ----------------------------------------------------------------------