[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL64389.1


[Show Plain Result]

## Summary of Sequence Search
   1::667
   7::166  PF03190 0.0% 46.875  Protein of unknown function, DUF255 
  32::92   PF00085 0.0% 36.2068965517241 PF00085 Thioredoxin 
   1::667


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDARERCLSSSSSPFVLEGLKSRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMDERTYNDEEVA
PF03190         ------rlaeekspYllqhaknpvdWypwgeealekakeedkpillsigysachWChvmeeesfedeeva
PF00085         -------------------------------enfeeevaksdklvlvefyApwCGhCkalaPey...ekl


                         -         -         *         -         -         -         -:140
query           EFINKHFIPVKVDRDERPDVDRRLQEAAQLISGQSGWPLTVFMTPKGQVIWAATYLPPRREMGLPGMLEV
PF03190         allnesfvpvkvdreerPdidkiymeavqaltgsggwPltvfltpdlkpffggtYfpkeeragapgflev
PF00085         aeelkekvvlakvdvdenkdla------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LEAVLRAYREKRGEVEKFHEDLARELKKWHSPSPGEPRREGQAEVLAALAASFDEEYGGFGGAPKFPPIT
PF03190         lekiaeaweeerekleeeaeelleal--------------------------------------------
PF00085         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QLELLMMRHFYDGVGIYGKMAERTLDAMALGGVYDQLLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYT
PF03190         ----------------------------------------------------------------------
PF00085         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KAYRQFGKALYKRTAEGIVKWLDEFMRAPEGGYYASQDADVDGEEGGYYRWSLEELKELLGELYPVASKH
PF03190         ----------------------------------------------------------------------
PF00085         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           FGLEEYPWPEGKATLRVARPLEGPEAERIYQILIEARRKRKPPFTDTTVYVGWSCAMAYAELLASRLASV
PF03190         ----------------------------------------------------------------------
PF00085         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GNKYHAVRTLERFGVELGQRGRLPRGFRGGGPVGIAALEDYAYCILAWIEGYSHTAKLEFLKVAESAGEI
PF03190         ----------------------------------------------------------------------
PF00085         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LLAKFLEEGGFKDVETVDEIIPTPNYPALDTPNFSGNAVAAIALATLSEVTGDAKYKEAAYRAVSALYGK
PF03190         ----------------------------------------------------------------------
PF00085         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           MERVGPAASGLWIALDLLTLGVPRTVIVGESPELITAALRAYRPWHVVVPITGNWPYKDPAVRAMLNGPK
PF03190         ----------------------------------------------------------------------
PF00085         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           PAAYICAGGACSLPVREPERLEKTIEEFMKTKYALPL---------------------------------
PF03190         ----------------------------------------------------------------------
PF00085         ----------------------------------------------------------------------