[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL64489.1


[Show Plain Result]

## Summary of Sequence Search
   1::816
  96::576  PF00384 0.0% 27.3170731707317  Molybdopterin oxidoreductase 
 691::770  PF01568 0.0% 34.6153846153846  Molydopterin dinucleotide binding domain 
   1::816


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTNLSRREFGKLVVTTALVSSSVAALKPLFEAKSAQVTQTGVEAVPITCAACGAACGLFFVRNGQRMYLL
PF00384         ----------------------------------------------------------------------
PF01568         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PNPKHPQPGMCFRPASALQLWNHPLRLKKPLKRVGERGEGKFQEVDWETALNEIAQRLREIVQRYGPESV
PF00384         -------------------------RlkyPmvRkqargeGkFvrvsWdeAleliaaslkytikkygpdrv
PF01568         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AFTRHDHMSWILPFIASVIGTPNIISHEGTCHAASTAVRKFVLGASGPSSVDPDYENANYILLIGRNLDA
PF00384         agfssgplmsmeslaslkkllsllggknlsfydwyadlppasaq.qtigsdsrsnyessnpledlensdl
PF01568         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AMGHIRRLTVAREKGVKVVVVDPRAPNLAYSSVEWIPINPGTDAAFVLSLIYVIISEGLYDAAFLKKYTN
PF00384         iilwGsNvreerpilnarirkaalkkkakvivigpryaellkfadewlaikpgtdaalalamghvilqel
PF01568         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           APFLIKPDGQPLTQKDLGQEGTAYLVYDNAAKSLAPHDKAQDPALDYEGEVQTPAGVIKVKTAFRLLAER
PF00384         kvdkeflrkytygkeetdmpllvtleee..........................................
PF01568         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AAKYTPENAEKITGIPADTIRRIAREFATSRGVAEDGWYTAKNGNDFDAYRAILILNALVGNIDKRGGLC
PF00384         ....................tgkkkevvariarelarnaaktagksmiivGaglnhrqdgdaiyravinL
PF01568         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           FQESSKFPSAVTVFQDRIETIIGHVLPPIKAQRLDRLKYPETPATFDALLDAIIEEKPYPVKALFIVATS
PF00384         allvgnvgqpgGgwahlnGqlilagaaekvgalpvllsvkslke..ekikf.aaeqpgnlgnfprnlfve
PF01568         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           PFHRDVNTEKLKKALQKLELIVAIDILPQDHIDWSDYVLPDLMFLEREEIGSIKWSLHAGIRYSHKVLDP
PF00384         rsnllkssgkkvlyllgnnpevdhadenevekalekldlvvvldgrltstalyaDiiLPaatwyEkedly
PF01568         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           PPGVDARSAFWALMEIIRRAFPEKAKIVEYDEKYADYNAFEHYEKKFFEAALRKLAETWKLDFEEIKEAL
PF00384         tndegrfqh...lkqa------------------------------------------------------
PF01568         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           ERDGFYILKKKTYETRPYKTPLGTPSGKVEIYTLRALKYGIDPLPDWIPPVYKIPQASDEFYLVNGKDNF
PF00384         ----------------------------------------------------------------------
PF01568         ------------------------------------------------------------lvLitgrtld


                         -         -         -         -         +         -         -:770
query           VSAHMVMVKNAKWIADRTVWMNPADAERLGIKDGDVVELEGLDNGFKAMAVVKVTNRVKPGVLFTYAFVG
PF00384         ----------------------------------------------------------------------
PF01568         qyhsqtrtrrvlrlaepepvveinpedaaalgikdGdlVevesrrG..svvvkakvtervrpgvvfmpfg


                         -         -         *         -         -         -         -:840
query           GRTSKLISGEYQFLKEGINPQWFTTGKVEPVVGSAPTNSSVRVRRL------------------------
PF00384         ----------------------------------------------------------------------
PF01568         ----------------------------------------------------------------------