[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL64528.1


[Show Plain Result]

## Summary of Sequence Search
   1::106
   9::104  PF00338 0.0% 40  Ribosomal protein S10p/S20e 
   1::106


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLASRRKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVRGPIPLPTRRLIVTVRRAPSGQGYHTFDHWE
PF00338         --------iriklkSydhkllekavkqiieaakrlglkvsgpiplPtkrkrvtvlrsphvd.kksreqfe


                         -         -         *         -         -         -         -:140
query           MRISKRLIDIEASERVLRRLMTIRVPDTVKIELQLI----------------------------------
PF00338         irthkrlidipdateetvdallkirlpegVevei------------------------------------