[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL64590.1


[Show Plain Result]

## Summary of Sequence Search
   1::213
   3::211  PF00926 0.0% 43.0851063829787  3,4-dihydroxy-2-butanone 4-phosphate synthase 
   1::213


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGIEDAIAAFKAGRLVMIYDGDDREAEVDFVIRADAVTPTTIRWLRQNAGGLLCFVTTREVGEILGLEFL
PF00926         --ieeaiealkaGklvivvDdedrEnegdlvvaAeavtpekvafmvrharGlicvalteeraeklgLppm


                         -         -         *         -         -         -         -:140
query           SSYYKRRGFLATAPYGDEPAFMGYVNHVKTKTGIRDVDKALTIRELAKVVQLAQRDPEEAREAFKANFYM
PF00926         vdkntsek.........ktaftvsvdhakgtttGIsaadRalTirkla............dekakaedfv


                         +         -         -         -         -         *         -:210
query           PGHVPILGGRLGERWGHTELSLILAKAAGVPPAVVIVEVLGDHTEAMPVEEAREYSKTLGVPLVTGTEIK
PF00926         rPGhvfplrakeggvlerrGhTEaavdLarlagltpaaviceildddgsmarleelkefakehglkliti


                         -         -         -         +         -         -         -:280
query           SLI-------------------------------------------------------------------
PF00926         e---------------------------------------------------------------------