[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL64645.1


[Show Plain Result]

## Summary of Sequence Search
   1::546
  11::468  PF03600 0.0% 21.3559322033898  Citrate transporter 
 488::533  PF03600 0.0% 21.7391304347826  Citrate transporter 
 284::349  PF02080 0.0% 27.2727272727273  TrkA-C domain 
   1::546


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDIWFVATVSAVLAAVTLSFKYRADIIAFVSLMALVLVGVYDLREALSYLISPAVIVLFGSMVISGVIAD
PF03600         ----------milvileviarkrlsviaallivallaalikagagptmekaiaeialtflvLLfaimf.g
PF03600         ----------milvileviarkrlsviaallivallaalikagagptmekaiaeialtflvLLfaimf.g
PF02080         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SGLLDRVARYISVRVRHVATASLLLYFVAGVASGFVSDVAIVLAMAVLIGDVAKRLGASPAAYVIPLAFA
PF03600         kiledtGlfdplaeklirivkgdplkllvlvalvsailsligdnttvvlilvpvvl.plykrlnlspsll
PF03600         kiledtGlfdplaeklirivkgdplkllvlvalvsailsligdnttvvlilvpvvl.plykrlnlspsll
PF02080         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AAIGGRLTMVGNAGNVILLDIYQTTTGEKLNILAFTAPALLALAISVPLLLLISFYAQRFVPQLSTAVKF
PF03600         lmaialaaniggmltpvGgPqnvvv....raaaglsffsteffaalipgvilglllvillllvlgkk...
PF03600         lmaialaaniggmltpvGgPqnvvv....raaaglsffsteffaalipgvilglllvillllvlgkk...
PF02080         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LVVTTEVGETLDGKTRQEVEKAYRVKILTKDRILLKYSTVLVKIAVSDIPSFMTSKDLILRPLGNNKGEH
PF03600         ......................................................................
PF03600         ......................................................................
PF02080         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           MEFLIVTQRSRLVGKTLALEPIHNVFPVSIIGIVPSGPVESLESYVFRPGDEILVLGDEKVIERIAAYYR
PF03600         ......................................................................
PF03600         ......................................................................
PF02080         ---vtvpegsplvGktlkelnlrerygvlvvairRggeviiprgdtvLepGDvllvvgspedlaelael-


                         -         -         -         -         *         -         -:420
query           LERSKTLVKAFNPRLAASGISGLFAAVVLSQFAPASLAFIIGTFIALLGGGKAVERLYQYVSWETLIYVG
PF03600         ..........arplllksnaiLvlvlmlvll....vvglvplwialligillalllnykdlkeqlerlea
PF03600         ..........arplllksnaiLvlvlmlvll....vvglvplwialligillalllnykdlkeqlerlea
PF02080         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           SFLAIGTAAARIDLLKPITPLLNSPEYLFVIGLFLTNTLGLIPSAVLIGPYLTTKEMLMTYVLATIPILL
PF03600         hagvalsvllliaaafvfvgvlqktgmfdalaellvnvlkalipeail-------------------mlt
PF03600         hagvalsvllliaaafvfvgvlqktgmfdalaellvnvlkalipeail-------------------mlt
PF02080         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           PPAHPAIYLIYREYGLSIKDFLKISIPATAIAILATGIAVYLYYNLPIQTPIFQLP--------------
PF03600         pvGgPqnvvvraaaglsffsteffaalipgvilglllvillll---------------------------
PF03600         pvGgPqnvvvraaaglsffsteffaalipgvilglllvillll---------------------------
PF02080         ----------------------------------------------------------------------