[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL64884.1


[Show Plain Result]

## Summary of Sequence Search
   1::222
   7::116  PF01656 0.0% 38.1578947368421  CobQ/CobB/MinD/ParA nucleotide binding domain 
   1::222


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIRTGTVAFTSCKGGAGKTTLAVNVSAALPLNVLLIDLGGGASRFFPAPLINIENITPTIEAYRDARVKN
PF01656         ------iaiaggkGGvGKTtlaanLaralakrglrVlliDlDpqannssllgkv.........eilkkgl


                         -         -         *         -         -         -         -:140
query           LFVIPIAIDPASVWRIENWEEIFQNLTDAVRKNIVKNSIDVVVLDMYQLSRITPIETFGLDKADLIVLVV
PF01656         ekasal.........................lenfeagllaegeeg------------------------


                         +         -         -         -         -         *         -:210
query           EGCEDCTKPITIIKKFFDGKLIIALNKHERGIEYPGAVVKIPFSATLDYYNRRGQFYTKPVTKLAEYLLQ
PF01656         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ELKRVTRSRWIE----------------------------------------------------------
PF01656         ----------------------------------------------------------------------