[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL64909.1


[Show Plain Result]

## Summary of Sequence Search
   1::270
   2::258  PF02598 0.0% 42.570281124498  Uncharacterized ACR, COG2106 
   1::270


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFSIAIPHDFLSEIPDEAGKVRKLGYLARAAAIFKAEYIIIYHYGTPRREDIDFAKTVLEYLVTPPYLRK
PF02598         -vsvaiPssilsnakdleqktylayqiARaatiFnVdeiviyddeekekekeekenkkskknkeeaklla


                         -         -         *         -         -         -         -:140
query           KVYKIDNRLKLAGLLPPLKIPSHTVPVEPRIGEIREGIVERWDGYYSLIYIGGGKYAKVPKPYPIGTRLL
PF02598         tlLqYletPqYLrksvFpitkeLkyaglLppLdaphhl.sreseegeyReGlvikkskkkekkklvniGl


                         +         -         -         -         -         *         -:210
query           VRIEGTTSRPDTYRAAVYRGAPPDYWGYKIDVRPLQNLSEGFDTVILTGKEGKSICEAKPKIGKKTLVVF
PF02598         eknvelesqevpigvRvtvdiks......lkkkvVspaepygakaywGYkvriakslsdvfkessfkeGY


                         -         -         -         +         -         -         -:280
query           GGPRKGVDEIFREAGLEPPGELINFAPGQGVETIRTEEAVFIVLSILNYIAKCSYKREAL----------
PF02598         dvtigtsergkdiseaeleikesnkkklllvfGkwehkkesfeslkkq----------------------