[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL64927.1


[Show Plain Result]

## Summary of Sequence Search
   1::999
  22::486  PF03065 0.0% 45.014245014245  Glycosyl hydrolase family 57 
 690::904  PF09985 0.0% 45.2380952380952  Domain of unknown function (DUF2223) 
   1::999


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKWTFLLTLFVIFLAAEPINIIFIFHNHQPWYLDFSKNELALPWVRMHAVGNYLKVPLLINQSGVSVAFT
PF03065         ---------------------afvvhqhqplyrspgegeyelpwvrlhaakdYiplisllekfpeikvtv
PF09985         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LSGSLIEQLNWYSNGTYTDARFRISEKIARGEPLTIEEKYAMLAVPGGFFDINWQNILNKHPRYAVLLGV
PF03065         slsGslleqledylnev.kdkyleis..iakeelltt.ekekllea........................
PF09985         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RNDAFNKCPPGNMTCVVSRFSDQDFIDLATLFNLLWIDPYIARQNPEIWALRNKTNYTREDLKKVLQIHL
PF03065         ........................................................nftredlkkvlskq
PF09985         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ELIKQVLPVYKKLAEQGRIELVPVPYSHPLMPLLADMGAIYDLKLHVNLSNSLFKRYLGVTPTGVWPPEQ
PF03065         lellknilelfrellesgqvElltspyyHpllpllad...sedieaqvkkakelykeyfgvePrgfwlpE
PF09985         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AVNDEVLRLFANAGYIWTVTDEDVLKATAPGASHFKLYFVQYGDRKLYVFFRDKTLSDNIGFRYSSLSPE
PF03065         lavspeileilaeaGieyvltdeavliksvessenlyrpYlaeanggkgiavffRnkelsdligfryggl
PF09985         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AALADFVNYLKRVPREKCSVVVIALDGENPWENYPNFGDDFLRVFFQGLAQLEKNGTVKIWKPSDFIKAC
PF03065         ptdeavedfinyllaklaakasedkgevvvialDgenfweehpengsgfleelyqlleeleknglielvt
PF09985         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GNEAAELPQREFKYFDLHLDLSFYKSIRDLPTRLVNGRIAEGSWSGGGSLAVWIGDPDENVWWMWLKKAR
PF03065         vsefikkfkpkaiilapqaael...........................gsWaddgslsaWignpt----
PF09985         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EEVGVNRTWDVIFPLLIAEASDWPFWYGGDMGSPITFDPIAKSALITYYKRAGLEPPRYLLSPAYPAGTP
PF03065         ----------------------------------------------------------------------
PF09985         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           REDKVAGRGDGRIRTYQGLTVHVNTTHIWAEGAPCGVLYISNPDIPRSPYIFRGAVRGIYGESLNIIADM
PF03065         ----------------------------------------------------------------------
PF09985         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           AIDTCSGVVYLSDGGVFYPVGRAASLSFIGARPGGRLYLEFKGLVYIVNIPEAEVAQQLLLKAADPVGDD
PF03065         ----------------------------------------------------------------------
PF09985         -----------------------------------------------------------ilelkDplGDd


                         -         -         -         -         +         -         -:770
query           FGPGRYQYPKNPVFKPGVFDLTEFSLYDVGDKLRFVFKVRELGDNPWGGPAGFSLQFFHVYINRGSGSRN
PF03065         ----------------------------------------------------------------------
PF09985         nGpGtytYPtnkvfkpglfDLtkvrvlekgdeyvfkvklael.tNpWngpnGfSlqliniYldtkegget


                         -         -         *         -         -         -         -:840
query           DTLGLRVALCRDAAWDVALLIGPGWSGGNRIVYSDNTYVDDAMSIKVAPNNTVVADVPKRYIGEFNSSWK
PF03065         ----------------------------------------------------------------------
PF09985         sllkpGanvel..ehpWdvalkia.gwdtqgeavkaadGtkvtsevkvevdpenntIvvkvpkkllelek


                         +         -         -         -         -         *         -:910
query           ITVFLTSWDGYGPDNIRNFGVVSDEWTAGGADPVAVLANVAPRVFDLLAETAEQQIKALTSYQVTRLPNG
PF03065         ----------------------------------------------------------------------
PF09985         nlaklkvavlvgsydgygpdkvRpvaveateWelGgadpsa.tadvaPrvvDvlvpegqkQeev------


                         -         -         -         +         -         -         -:980
query           TYLGRPTRVCAYISGGKATETYTVTQTITITQTEVSTTTKTIATRETITSTYVTTATQVIKEADWTTASL
PF03065         ----------------------------------------------------------------------
PF09985         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           IGILALTIGLVAGLLTRRR---------------------------------------------------
PF03065         ----------------------------------------------------------------------
PF09985         ----------------------------------------------------------------------