[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL64945.1


[Show Plain Result]

## Summary of Sequence Search
   1::181
  11::170  PF01558 0.0% 36.1290322580645  Pyruvate ferredoxin/flavodoxin oxidoreductase 
   1::181


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MATSLVIVGVGGQGVLTLARWIGEAALAEGYDVRIAEVHGMSQRGGSVEVHVRYGKDIYAPIVEEGGADY
PF01558         ----------GGqGvvtagkilakaaaraGyyvfanpeygseirggpvyshvrisdeppvtsieveeadl


                         -         -         *         -         -         -         -:140
query           VIALEALEALRAYKYLKRGGELIVNRRVIQPPGNWLEEEEVFKAILTSGLKSYIVPCFDIAIELGSPLYE
PF01558         lvaldaetlkrhlddlkpggiiiynssevkpedlkkakeeeraake....rvyavpateiakelggnera


                         +         -         -         -         -         *         -:210
query           NAVMLGFFSQLAGLPMPPSLDERNREAFRRGALVYNSLAPY-----------------------------
PF01558         aNtvllGalaallgldl.ealeeaikeafa----------------------------------------