[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL64946.1


[Show Plain Result]

## Summary of Sequence Search
   1::390
 168::299  PF02775 0.0% 30.952380952381  Thiamine pyrophosphate enzyme, C-terminal TPP bindi 
 322::336  PF00037 0.0% 46.6666666666667  4Fe-4S binding domain 
 353::374  PF00037 0.0% 50  4Fe-4S binding domain 
   1::390


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDKWRELEKLSSDFLQIEGSGDVVIVTSGVAYNYVKEAVRRLNIRATVVKLGISVPVPPKVREIARGGEV
PF02775         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VVVEEGDPVVEIQLRALGINTRGKIDGYFPKHGELDINKTALGLAKALGLSYAPPTPLKPPLEPPPRPPV
PF02775         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LCPGCPHMATFYILRLATAGLNPVWSGDIGCYSLGINTGQQDLITHMGSSVGLGAGIALATGQFVVATVG
PF02775         ---------------------------diGchtlwaarlkvkrprsyltsgglgtmGyglpaAiGaklak
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DSTFYHAVLPQLVDIATRSVPILIVVMDNAYTAMTGGQPSPSRAIPAERITEAFGISTFVIDPIDVKKSV
PF02775         pdrevvaivGDGgflmi.lqelatavrrnlpitvvvlnNegygmtggqqepfggkrksgpdgkklkpvdf
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EIIKKAVEIVKSGRPAVVVSRRPCALIGVRKARRAGIQLPKYQVDVNKCTGCGLCYNLLKCSAIYKRPDR
PF02775         aklaealGakgarveka..---------------------------------------------------
PF00037         -----------------------------------------vvideekCigCGaCv--------------
PF00037         -----------------------------------------vvideekCigCGaCv--------------


                         -         -         -         -         *         -         -:420
query           KAHVDPALCVGCGICAEVCPFNAFKPEGKREAWLELWRQA------------------------------
PF02775         ----------------------------------------------------------------------
PF00037         --videekCigCGaCvevCPvgAI----------------------------------------------
PF00037         --videekCigCGaCvevCPvgAI----------------------------------------------