[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL64972.1


[Show Plain Result]

## Summary of Sequence Search
   1::251
   4::155  PF00239 0.0% 37.8571428571429  Resolvase, N terminal domain 
 136::149  PF04545 0.0% 50  Sigma-70, region 4 
 169::201  PF04545 0.0% 27.2727272727273  Sigma-70, region 4 
   1::251


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MITAVTYIRVSTEEQDPENQRVFLERWAGERGIYIVKHYVDVGVSGATEPWERPAFRQMASEVDKLEPRP
PF00239         ---aigYaRvSteeqglerQlealeayakek.wkivkefedkgvsGkkae..Rpelqrlledlre...g.
PF04545         ----------------------------------------------------------------------
PF04545         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RVLLVYEISRLVRSFQELFTLLDVVENRLGLVVVSASEREQALQNLDGVYRQFLRAVLAFVATMEREFIR
PF00239         dvlvvekldRlgRslrdllelleel.eekgvklvslde.g..idtstpa.grllltilaalaeferelis
PF04545         -----------------------------------------------------------------rerVr
PF04545         -----------------------------------------------------------------rerVr


                         +         -         -         -         -         *         -:210
query           QRTKTALERARLQGKVWNVAEKRRDLTQAVVEMYLSGASLRETARAFGLSLYEVRRILSNAGVYRPSPYT
PF00239         ertkegiaaakakGk-------------------------------------------------------
PF04545         qiekrAlrk-------------------evlelrfgeglTleEiGerlgisrerVrqiekr---------
PF04545         qiekrAlrk-------------------evlelrfgeglTleEiGerlgisrerVrqiekr---------


                         -         -         -         +         -         -         -:280
query           CPRCFSKMKVAERTAKISNGKYTVVERLYCYNCGYEEIREG-----------------------------
PF00239         ----------------------------------------------------------------------
PF04545         ----------------------------------------------------------------------
PF04545         ----------------------------------------------------------------------