[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL65054.1


[Show Plain Result]

## Summary of Sequence Search
   1::346
 235::291  PF06858 0.0% 54.3859649122807  Nucleolar GTP-binding protein 1 (NOG1) 
 180::289  PF01926 0.0% 31.4285714285714  GTPase of unknown function 
 170::299  PF02421 0.0% 31.1475409836066  Ferrous iron transport protein B 
 171::291  PF08477 0.0% 24.5614035087719  Miro-like protein 
 170::243  PF04548 0.0% 30.1369863013699  AIG1 family 
   1::346


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEVVDKSKLPYVYAADELISLFLTTYSREEARGSTAEPAFVKQKRLEIKRIVSSGKAIASILREMALRMP
PF06858         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF08477         ----------------------------------------------------------------------
PF04548         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FLDRLHPFYRELIDAVIGARAYKHVVAKVGNANLAVKAIAKEAITAVRTAPDKKALLDARRMYKARIIDL
PF06858         ----------------------------------------------------------------------
PF01926         ----------------------------------------------------------------------
PF02421         ----------------------------------------------------------------------
PF08477         ----------------------------------------------------------------------
PF04548         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LNDLRPELEKMREIVVFLRKLPSIDPELFTIVVAGAPNVGKSSFVRCVSTAKPEVAEYPFTTKQIHLGHI
PF06858         ----------------------------------------------------------------------
PF01926         ---------------------------------------GKStLinaltgkakakvanypgtTrdpnegk
PF02421         -----------------------------tvalvGnpnvGKttlfnaltgakqkvgNwpGvTVekkegkl
PF08477         ------------------------------vvvvGdkgvGKssllsqlvgeefpkkklpeeikgdtlavk
PF04548         -----------------------------tivlvGktgnGkSaTgNsilgkkaFesklsaqsvtkkcqkk


                         -         -         -         +         -         -         -:280
query           FLRGDRVQVIDTPGLLDRPLSERNQIEKQAILALRHLAGVIVFVVDPTPHSGYSLEMQERLWREIKEGFS
PF06858         ------------------------eiEkqaitALahlraavlflfDlseqcgysleeQlkLfkeikelFk
PF01926         vkledgkeitliDtpGiiegadkkegelgkkflealee.adllllvvdaseplt....kndleladlele
PF02421         klkgkeveivDLPGiYsLsayseeekvardyll..eekpdviinvvDas.....nlernLyLtlqlle.l
PF08477         tlevdvdtel......lelwdlggreelkkehell.lkkadaillvydltdeesleevsellawlaelrk
PF04548         srtwdgkkinViDTPglfdlsvs.adkiskeiv-------------------------------------


                         -         *         -         -         -         -         +:350
query           APAVAVLNKIDIATEEELEKARAIFAPIGEISTLNCRGTKEVMDYVLQKYYVPAALEKLRAAARGR----
PF06858         nkpvivVlnKi-----------------------------------------------------------
PF01926         kkkkplllv-------------------------------------------------------------
PF02421         gvpvvvalnmiDeaekkgi---------------------------------------------------
PF08477         lgkkipvilvg-----------------------------------------------------------
PF04548         ----------------------------------------------------------------------