[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL65065.1


[Show Plain Result]

## Summary of Sequence Search
   1::306
   3::289  PF06626 0.0% 54.7703180212014  Protein of unknown function (DUF1152) 
   1::306


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPLYLAVGGGGDVVMAAALAGEEAVGQIPWERYVVDPEPGPVPPPSLREVLDLGNGLYLATPRSFAERGG
PF06626         --lvlgiGGGGDvvsaavvakalrkegeeavlgsvvWeRlvvDPePGPipleelreveaineavaivnee


                         -         -         *         -         -         -         -:140
query           RLFKTQGMCVAEALQKSVYLVDPYRRPSELAKALVRFDKIIGVDVGGDVLGVGCEESLRSPLADAYGLAV
PF06626         syairggrrvvpqlvrvakalgkevylvdlkkgveglaealkelaeklgidkivgvDvGGDvLakGceet


                         +         -         -         -         -         *         -:210
query           LAKASELGVEAELWVMSPGADGELSLEYLIRRVAEAAREGGLLGTVGLDSKQVEVLEKLVKRCVTEASAV
PF06626         lrSPLaDaiglavlaklee...eavlaviglGsDGELsreyllkriseiareggllgivgldkedvelle


                         -         -         -         +         -         -         -:280
query           AVRAFKGEYGPAHIRGGARLVEIGACALIGFKFSPKALLKLNKAARLIYESDAPIDKAADLLIENGIPTE
PF06626         klveevvteAskiplkafrGeyGeleiRkgtrkvevsplsavtffldpeavaelsklaklv.eeseslee


                         -         *         -         -         -         -         +:350
query           LHLEQLLAKGLDIYAALEELKKKKSC--------------------------------------------
PF06626         aneklnelg-------------------------------------------------------------