[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL65069.1


[Show Plain Result]

## Summary of Sequence Search
   1::315
  31::294  PF00155 0.0% 23.9382239382239  Aminotransferase class I and II 
   1::315


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MYEIEMFKWIREKNGVYDLASSGVLKLEAPQAEAPPLEEVLIELYDIPRQNLAIVSGAQEGNFLAFLAVK
PF00155         ------------------------------idglpeleealakflgrseklklkreaavvvgsGagalie


                         -         -         *         -         -         -         -:140
query           PEYAVITVPEYEPIIKLPSSLGVRHVKVWDVWEAPIKPGGVLIFSNPNNPTGRYLEKRELAELADEARRK
PF00155         alifllklnpgdeilvpdptyasyknilrlsgge.vvryplyseedfhldlealeealkeapegnkktkv


                         +         -         -         -         -         *         -:210
query           GAYLIIDIIFSDFVTDDLRGFPLENVAYSHSTDKFYTHDLRAGWVFGDEEIVRRVKYLKDLANPGPREAE
PF00155         vlvesphNPtGtvatleeleklldlakkynlllfvDeaYagfvfgsldavatranveeepnllivgslsK


                         -         -         -         +         -         -         -:280
query           RKAAAALLSRRAEVKRRNLSIIKPNATALLTRFPNALYKPHMPIALIPTGCNDAKLAERLLAMGVKTVPG
PF00155         a.fGlaGeRvGyilgnaavvsqlrklsrpfls..ssllqaavaaalsdallkqseleemrqrlqkrrkel


                         -         *         -         -         -         -         +:350
query           RLFQAPYSIRVGLGVEEPPRFREALEILAQGWCRA-----------------------------------
PF00155         rdeLael.glkvla--------------------------------------------------------