[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for paer1:AAL65085.1


[Show Plain Result]

## Summary of Sequence Search
   1::364
 103::255  PF04055 0.0% 29.1390728476821  Radical SAM superfamily 
 278::326  PF04055 0.0% 26.0869565217391  Radical SAM superfamily 
   1::364


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSRAVYSWPAPVYKPGEYLLKLPNVRESPYQTREEGGSVVCTLCHRRCRLPPGKIGACGMRFNLGGRLYT
PF04055         ----------------------------------------------------------------------
PF04055         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AAYGLLTAAESRPMEIKPLYHFYPGTSAVTISTWGCNFPCAWCQNWHLSKTASPAGAYVPPERVVEWALE
PF04055         --------------------------------trgCnlrCsfCanpet..sregrgrsrsveeileevke
PF04055         --------------------------------trgCnlrCsfCanpet..sregrgrsrsveeileevke


                         +         -         -         -         -         *         -:210
query           NGDSGVNVSFNEPTLLAEYAEEVFRLARARGLHASINTNGYLTEEAVRRLAEAGMEGMNIDIKGGRETYR
PF04055         lkeekgvkevtltGgepllypdfvellerlaklalpgirialetngtlpdeeileelaelgvdrvslgle
PF04055         lkeekgvkevtltGgepllypdfvellerlaklalpgirialetngtlpdeeileelaelgvdrvslgle


                         -         -         -         +         -         -         -:280
query           RWLAANFDKFLSTARHAKGMGIHVEFTYLVIPGVNDHEAEEVIEAVASFGRETPLHITAYYPAHKLFNPP
PF04055         sgdeekvlklmrrghtfeevlealeklreagikrvvdfivglpge----------------------ngt
PF04055         sgdeekvlklmrrghtfeevlealeklreagikrvvdfivglpge----------------------ngt


                         -         *         -         -         -         -         +:350
query           TPPELLEELWRRARRELDYVYVGNVPGHPGQHTYCPRCGYAVIKRAGDRAVKIELAQGRCPKCGWEIPIR
PF04055         lpdeeileelaelg...vdrvslglesgdeekvlklmrrghtfeev------------------------
PF04055         lpdeeileelaelg...vdrvslglesgdeekvlklmrrghtfeev------------------------


                         -         -         -         -         *         -         -:420
query           GKPGKYGRLYRSFI--------------------------------------------------------
PF04055         ----------------------------------------------------------------------
PF04055         ----------------------------------------------------------------------