[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL62507.1


[Show Plain Result]

## Summary of Sequence Search
   1::313
  47::269  1.8e-14 19.2% 0045817 00458171 1/1   lasmic binding protein-like II          
  46::269  1.1e-13 24.8% 0049726 00497261 1/1   lasmic binding protein-like II          
  47::256  1.7e-09 23.7% 0046289 00462891 1/1   lasmic binding protein-like II          
  45::256    3e-09 20.7% 0042594 00425941 1/1   lasmic binding protein-like II          
  39::238  9.3e-07 22.0% 0048733 00487331 1/1   lasmic binding protein-like II          
  47::182  1.7e-06 25.0% 0051197 00511971 1/1   lasmic binding protein-like II          
  46::187  3.6e-06 24.8% 0051251 00512511 1/1   lasmic binding protein-like II          
  43::256    7e-06 23.9% 0051126 00511261 1/1   lasmic binding protein-like II          
  46::256  7.4e-06 19.7% 0043543 00435431 1/1   lasmic binding protein-like II          
  47::256  9.2e-06 21.5% 0048393 00483931 1/1   lasmic binding protein-like II          
  46::149   0.0004 24.2% 0045793 00457931 1/1   lasmic binding protein-like II          
   1::313


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKIGYLIIIIVAIVAVAALLAIPRPQAPMTQTPMAQASTSTTTPQKIVLYMATTTSVKDTGLLDVLIPD
00458171   1/1  ----------------------------------------------eltvaaaaslt....daleelaea
00497261   1/1  ---------------------------------------------se..ltvagssslap..llealaea
00462891   1/1  ----------------------------------------------eltvytwggy.....daleelaka
00425941   1/1  --------------------------------------------egeltvytwgsl.....ylleellka
00487331   1/1  --------------------------------------laaagaaaagt.ltiagsstvap..llealae
00511971   1/1  ----------------------------------------------Gtltvyswggy.....ealeelak
00512511   1/1  ---------------------------------------------gtltvytwggy.....daleelaka
00511261   1/1  ------------------------------------------aaegeLtvytags.....ydllkallda
00435431   1/1  ---------------------------------------------aagtLtvysasgltd..alkelaka
00483931   1/1  ----------------------------------------------eLtvysagg.....yealeelaka
00457931   1/1  ---------------------------------------------eeltvaaaasl....kdaleelaaa


                         -         -         *         -         -         -         -:140
query           FEKWAASRGYNIEVRYTAVGTGQALAMAARGDVDVVIVHAPSLEKQYLENGTLKCRDVIAYNFFIIVGPR
00458171   1/1  Fek.....etgikVvvsfggsgalaaqieagapaDvflsadakaldklvkegllvpgsrvplalgalvlv
00497261   1/1  Fekeypg....ikvnvvaggsgallaqllagpaDvvlssdpllleelaa..glvavpv.aydglvvvvpp
00462891   1/1  Fek....e.tgikvevvtggsgellakllaeaggsppDvvlsadagllarlakaGllaplddllldpnld
00425941   1/1  Fek....e.tgikVevvtggsgllakllaegggsgaDvvlvadadllaklakagllepldssklpnllpa
00487331   1/1  afekanp....gvkvnvesgGsgaglkallagtaDiaassrplkdeelaaagglveipvaldgivvvvnk
00511971   1/1  aFek....e.tgikvevvfggsgdllakllaalaagnpDvvlsadadllaklaeaGllapldddflpall
00512511   1/1  Fek....e.tgikvevvtggsgllakllaeaagsgpDvvlsadagllaklaeaGllaplddldflpalld
00511261   1/1  Fek....e.tgikvevvfggsgellakllaegggspaDvvlsadadllarlaeagllapldspnldnipp
00435431   1/1  FekkykeetgtgikveyvyggsgallakllagaqaDvvasadagdldrlakagllqpldpkklpyavpla
00483931   1/1  Fek.....etgikVevvtggsgellaklkaegggapaDvvlsadadllarlakaGllapldspnldnlpp
00457931   1/1  Fek....e.tgvkvevsfggsgalarqieegapaDvflsadaalldklvekglvvpgsrvtlalnrlvlv


                         +         -         -         -         -         *         -:210
query           DDPAGAKSLTATEAFRRIAEAKAPFVSRGDRSGTHLMELSLWRRAIGREPDPKNDTWYISAGAGMGQTLL
00458171   1/1  vnkgnpv.......iksladLakpnlkrvaiadpkiapygtaake..lleklg..lldalkakpklvpae
00497261   1/1  gnp..vlvlnkdqlakiflgkitswkdLakpdlkikvvlrdpgsgtrglflaallagldlalellkglkp
00462891   1/1  dllpalldldgvpyavgtlvlvynkdlfkkagl..PktwddLld.pklkgkvalg.pssgtgglallall
00425941   1/1  alddgngygvpyavgtlvlvynkdllkeaglPkswddLld.pklkgkvalldptsgyglallaaglslyg
00487331   1/1  dnpvag.lkLtveqladiflgkitnWsdvdiaalnpglglpdlpivvvgrsdgsgtrdaftelllgkspe
00511971   1/1  daatvdgklygvPyavgtlvlvynkdl.gldpkdpktwddll----------------------------
00512511   1/1  aatdpdgklyglpygtlvlvynkdlkfkk...pk.wddLld...pkl-----------------------
00511261   1/1  elrdgdgywvplalgalvlvynkdllkeaglPkswddLld....pelkgkialadp.sgtglallaallq
00435431   1/1  tgtlvlivnkdnpkkikswdd......Llkpgvkvvlpdpktsgtgrlallallaaglskdkgdeekale
00483931   1/1  nlrdpdgklygvplavgtlvlvynkdllkeaglPkswedLldpklkgkialadp.sssgtgllaa..lla
00457931   1/1  vpkgnpkdi-------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LANEKSAYTLSDTGTWLRYRDKLPQLDVIVQAAPDLINIYSFSIVKLSNATRLMAQYMKTRGLEVIGNLT
00458171   1/1  gvgqvlqavasgeadlgfvylsdalaavakgvklvivlpeegylpivypaavlkgaknk-----------
00497261   1/1  nvvvlgsngavlqavasgegaigyvslsya.laalkgvkleivvpseetlaegsypinr-----------
00462891   1/1  aalggvkaleflkklkkngavvp..ggsealqlfasGeaamgisgs------------------------
00425941   1/1  ed...kalellkklkpnvvvvtkggssqalqlfasGevaigivysg------------------------
00487331   1/1  lwdkkvgklvlvglpldgnvveaegng.------------------------------------------
00511971   1/1  ----------------------------------------------------------------------
00512511   1/1  ----------------------------------------------------------------------
00511261   1/1  alGeekalellkklkknga..vtgsgsdvlkavasGevaigivysy------------------------
00435431   1/1  flkklkknvvvlassgvgavlaavasGeadvgivwegyallakkel------------------------
00483931   1/1  alggdkalellkklkkng..vvtksvsaalqavasGeaaaglvysg------------------------
00457931   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           INGVSLFTPINKADPKAMEWIKTAIFGPSCVER-------------------------------------
00458171   1/1  ----------------------------------------------------------------------
00497261   1/1  ----------------------------------------------------------------------
00462891   1/1  ----------------------------------------------------------------------
00425941   1/1  ----------------------------------------------------------------------
00487331   1/1  ----------------------------------------------------------------------
00511971   1/1  ----------------------------------------------------------------------
00512511   1/1  ----------------------------------------------------------------------
00511261   1/1  ----------------------------------------------------------------------
00435431   1/1  ----------------------------------------------------------------------
00483931   1/1  ----------------------------------------------------------------------
00457931   1/1  ----------------------------------------------------------------------