[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL62792.1


[Show Plain Result]

## Summary of Sequence Search
   1::394
   1::245  5.6e-35 30.6% 0050959 00509591 1/1   otide-diphospho-sugar transferases      
   3::251  5.3e-33 27.9% 0052019 00520191 1/1   otide-diphospho-sugar transferases      
   1::181  6.7e-29 36.5% 0048604 00486041 1/1   otide-diphospho-sugar transferases      
   3::182  9.8e-21 30.7% 0042758 00427581 1/1   otide-diphospho-sugar transferases      
   4::192  2.2e-20 27.6% 0046833 00468331 1/1   otide-diphospho-sugar transferases      
   1::183  2.3e-11 26.1% 0046778 00467781 1/1   otide-diphospho-sugar transferases      
  19::185  3.4e-07 28.0% 0048137 00481371 1/1   otide-diphospho-sugar transferases      
  19::212  2.6e-06 24.6% 0050178 00501781 1/1   otide-diphospho-sugar transferases      
  19::189  5.1e-05 28.4% 0038462 00384621 1/1   otide-diphospho-sugar transferases      
  19::253  6.1e-05 27.3% 0047373 00473731 1/1   otide-diphospho-sugar transferases      
  19::185  7.3e-05 30.5% 0050195 00501951 1/1   otide-diphospho-sugar transferases      
  19::214  0.00045 29.1% 0044168 00441681 1/1   otide-diphospho-sugar transferases      
   1::394


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MCITVVLPTLNEAQALPKVVEELRATGYRDILVVDGGSTDGTVEEAKRLGLRVIGQYGRGKGMALRTALM
00509591   1/1  drslpdlrpplplpplppsslpkvsviiPtyNeeleylertlesllaqtypnfllEiivvDDgStDgtlk
00520191   1/1  --vsVviPayneeetigrvveslaaldypveiivvddgStDdTaelarraaaevfsrlgvevrvvlndgp
00486041   1/1  mmpkvsvviptyNeeeylertlesllaqtypdeiivvddgstdpetleileeladlrvrvirlpenlGka
00427581   1/1  --PkvSviiptyNeekyleecleSllnQtypnfEiivvDDgStDgtleilkeyakdprirvirneldled
00468331   1/1  ---maavsvviptynrpe.lrrtlesllaqdytyppfeiivvddgstdetleileelgakdprvrvirlp
00467781   1/1  LsllplllpllvglllllfsllllllllllrnlpvlrggrllpldlsslpkvsviIPtyNeeeylercle
00481371   1/1  ------------------tlerllaagideivvvtgykaleliaellgdgselglevtyvlqgeplgtad
00501781   1/1  ------------------vleallaagideivvvtgd..eeiaealgdygvevvyvrqdealgtggavla
00384621   1/1  ------------------vieaalaagiidivvv.gtddeeiedaldkygvevvltredalgtgdavlea
00473731   1/1  ------------------tlerllaagideivvvtgykarelieellgdgselglkvvyvlegeplgtad
00501951   1/1  ------------------tlerllaagideivvvtg..deeiaellsklgvevvyvvedealgtgplaav
00441681   1/1  ------------------vlealaaagideivvvtgykaelieellgdgsellsdllldlklellellrl


                         -         -         *         -         -         -         -:140
query           YVETPYVAVLDADYTYPPAELNKLVPLLRHYDVVIGARQGKMPALYKLGNKVLAWLFRVLFGVDLRDPLT
00509591   1/1  eileelaakypdrirvirlpenlGkaaarnaglkaargdyilflDaDdildpdwlerllaaleenpvdlv
00520191   1/1  lpenpGkgaAlntaleyalaaargeyvvflDADllsvdpdwlerlleplddgydlVkgyysrraldgrvt
00486041   1/1  aarnaglkaargdyvlflDaDdildpdwlerllaaleenpdvvvggrvrlinpdgsllrlgrrleyllar
00427581   1/1  lsdenlGlaaarnaglklargeyiaflDaDdildpdaleklvaaleknpdvdlvggdrliidedglilgl
00468331   1/1  npevptnprdknrylGkagarnaglkaalelpkgdyvlflDdDdilspdfleyfeellaaleadpdvgav
00467781   1/1  slhpflnqtypnfEiivvDd.................rleenfGkaaarNlGikaakglldadyilflDa
00481371   1/1  avllaldalgddpvlvllgDhplidpd.leelleahresgadvtvlvvpvedptgygvvevdedgrvlsf
00501781   1/1  alelladgddpvlvllgDvPlitpelidrllealresgadaavlvvpvedpegygvpnvvkvvldedgrv
00384621   1/1  lellgddpvlvlqgDvPlitpedldelleallesgadivvlvvevddpillalpgygvvvldedgrvlyf
00473731   1/1  avllalealgddpvlvllgDrplidpd.ldelleahresgadvtvlvvpvedp..tgygvvevdedgrvl
00501951   1/1  laalellgddpvlvllgDhplldpedldrllealresgadatllvvpvpdpepltgygygvvvldedgrv
00441681   1/1  lleglkityvlqgeplgtagavllaldllgddepvlvllgDvpl.dedlaelleahresgaavtvv..pv


                         +         -         -         -         -         *         -:210
query           GMYVARTDVLREAVTEARGFDLEVEILAKALANGARVAEVPIQYRERIGKKKLRPWHGVGIAVKALELAY
00509591   1/1  ggrrlvidedgqglvrggpllrrllsrllllllrlllgarlsddlgdltapgevpflsggfllfrreale
00520191   1/1  rllvrpllnallplaylsgfrqplgGefafrrealeavggfe.ellivsdwgeDidllirlvdlGlrihk
00486041   1/1  lllglglsdllggfalsgagllklfrrealeelggfderlf-----------------------------
00427581   1/1  srlllplflllllllsdlsgstllfrrelleevgglllllll----------------------------
00468331   1/1  ggr.....llnpdgslltrg.glsllgrvpflsgagllirrealeevggrfd------------------
00467781   1/1  Ddipepdwler.aaleepgvgvvggrillid............---------------------------
00481371   1/1  vekpdlppsq........lanaGiyvfrpdvl.daleelapsalg-------------------------
00501781   1/1  lgfvekpipltaerlllrrqdlpvsylinggiyafrpelllallegargeleltdvlellralaaggrva
00384621   1/1  vekpipyrrqdlapsylinggiyvfrpeillallellpgaleeiellea---------------------
00473731   1/1  efvekpdlpksnlantgiyvfnpgvlllllelllsalgeleltdilrallaaglkvyavlldgyewldvg
00501951   1/1  lrfvekpdafraelllyllnsgifleatsdlanagiyvfspevle-------------------------
00441681   1/1  pdpsgygvvvlde.grvlsfvekpdresllanagiyvfspelldllle..rgelyltdvlplllaag.kv


                         -         -         -         +         -         -         -:280
query           RLNPALFLTLIGALMLIPAVALGGWVAYRYFYQGVPHYMLGLAALLMLVIGGISTALLPLHTTIQQLRAS
00509591   1/1  evggfderlflyggeDvdlslrllraGyrivyvpe-----------------------------------
00520191   1/1  vkdpaaglsrmalqvlktllrlmatfgavwssikktvavpf-----------------------------
00486041   1/1  ----------------------------------------------------------------------
00427581   1/1  ----------------------------------------------------------------------
00468331   1/1  ----------------------------------------------------------------------
00467781   1/1  ----------------------------------------------------------------------
00481371   1/1  ----------------------------------------------------------------------
00501781   1/1  av--------------------------------------------------------------------
00384621   1/1  ----------------------------------------------------------------------
00473731   1/1  tpedlleaeidlavrekrlglavvdpeivisdlgligalvlis---------------------------
00501951   1/1  ----------------------------------------------------------------------
00441681   1/1  yavp------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IRRALIPPAPTDCLSPLPQPPPPAPPQRPAPEKATVLERAAQGLITAFIVLLAAAAYYLGIGDAATANKL
00509591   1/1  ----------------------------------------------------------------------
00520191   1/1  ----------------------------------------------------------------------
00486041   1/1  ----------------------------------------------------------------------
00427581   1/1  ----------------------------------------------------------------------
00468331   1/1  ----------------------------------------------------------------------
00467781   1/1  ----------------------------------------------------------------------
00481371   1/1  ----------------------------------------------------------------------
00501781   1/1  ----------------------------------------------------------------------
00384621   1/1  ----------------------------------------------------------------------
00473731   1/1  ----------------------------------------------------------------------
00501951   1/1  ----------------------------------------------------------------------
00441681   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AEWAYYALAGGVLATLIDTAIAQRRQKQLQRQAFRTSHSAVITS--------------------------
00509591   1/1  ----------------------------------------------------------------------
00520191   1/1  ----------------------------------------------------------------------
00486041   1/1  ----------------------------------------------------------------------
00427581   1/1  ----------------------------------------------------------------------
00468331   1/1  ----------------------------------------------------------------------
00467781   1/1  ----------------------------------------------------------------------
00481371   1/1  ----------------------------------------------------------------------
00501781   1/1  ----------------------------------------------------------------------
00384621   1/1  ----------------------------------------------------------------------
00473731   1/1  ----------------------------------------------------------------------
00501951   1/1  ----------------------------------------------------------------------
00441681   1/1  ----------------------------------------------------------------------