[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL62997.1


[Show Plain Result]

## Summary of Sequence Search
   1::379
   8::374    2e-39 30.4% 0049442 00494421 1/1   nosyl-L-methionine-dependent methyltran 
   6::375  6.5e-38 32.4% 0047465 00474651 1/1   nosyl-L-methionine-dependent methyltran 
  36::375  1.2e-35 27.9% 0051944 00519441 1/1   nosyl-L-methionine-dependent methyltran 
   9::378  2.5e-26 26.6% 0051823 00518231 1/1   nosyl-L-methionine-dependent methyltran 
   8::371  1.9e-21 26.2% 0051930 00519301 1/1   nosyl-L-methionine-dependent methyltran 
   9::358  1.8e-17 26.6% 0050745 00507451 1/1   nosyl-L-methionine-dependent methyltran 
  87::161    3e-15 37.3% 0051810 00518101 1/1   omain-like                              
  28::373  3.9e-15 25.5% 0051261 00512611 1/1   nosyl-L-methionine-dependent methyltran 
  87::162  6.9e-15 39.5% 0039128 00391281 1/1   omain-like                              
  88::161  4.2e-14 35.1% 0043106 00431061 1/1   omain-like                              
  88::161  1.1e-13 35.1% 0052541 00525411 1/1   omain-like                              
 195::365  2.3e-13 27.4% 0046568 00465681 1/1   nosyl-L-methionine-dependent methyltran 
  87::172  2.8e-13 35.7% 0042644 00426441 1/1   omain-like                              
 166::357  1.3e-11 21.6% 0049532 00495321 1/1   nosyl-L-methionine-dependent methyltran 
 173::373  9.3e-11 23.6% 0048490 00484901 1/1   nosyl-L-methionine-dependent methyltran 
  88::169  1.9e-10 31.7% 0052338 00523381 1/1   omain-like                              
 171::299  3.5e-10 25.0% 0052649 00526491 1/1   nosyl-L-methionine-dependent methyltran 
 170::371  4.1e-10 23.5% 0047923 00479231 1/1   nosyl-L-methionine-dependent methyltran 
 141::371  6.7e-10 24.8% 0037982 00379821 1/1   nosyl-L-methionine-dependent methyltran 
 201::334  1.5e-09 27.0% 0044550 00445501 1/1   nosyl-L-methionine-dependent methyltran 
 200::333  1.9e-09 28.8% 0047945 00479451 1/1   nosyl-L-methionine-dependent methyltran 
 177::375  3.7e-09 22.0% 0040829 00408291 1/1   nosyl-L-methionine-dependent methyltran 
  89::160  4.9e-09 23.6% 0049549 00495491 1/1   omain-like                              
 208::339  4.9e-09 26.8% 0041580 00415801 1/1   nosyl-L-methionine-dependent methyltran 
 172::375  5.3e-09 20.2% 0049122 00491221 1/1   nosyl-L-methionine-dependent methyltran 
 201::354  8.7e-09 28.1% 0052749 00527491 1/1   nosyl-L-methionine-dependent methyltran 
 162::374  1.2e-08 22.2% 0046744 00467441 1/1   nosyl-L-methionine-dependent methyltran 
 201::275  1.6e-08 30.1% 0050519 00505191 1/1   nosyl-L-methionine-dependent methyltran 
 150::344  1.8e-08 26.2% 0046354 00463541 1/1   nosyl-L-methionine-dependent methyltran 
 201::372  2.2e-08 23.3% 0048805 00488051 1/1   nosyl-L-methionine-dependent methyltran 
 116::337  2.4e-08 23.4% 0051884 00518841 1/1   nosyl-L-methionine-dependent methyltran 
 169::310  3.5e-08 23.7% 0052618 00526181 1/1   nosyl-L-methionine-dependent methyltran 
 181::363  6.2e-08 21.7% 0048438 00484381 1/1   nosyl-L-methionine-dependent methyltran 
 163::340  6.6e-08 21.3% 0053110 00531101 1/1   nosyl-L-methionine-dependent methyltran 
 162::345    1e-07 17.2% 0053107 00531071 1/1   nosyl-L-methionine-dependent methyltran 
 171::326    1e-07 24.3% 0051449 00514491 1/1   nosyl-L-methionine-dependent methyltran 
 176::374  1.2e-07 20.6% 0049474 00494741 1/1   nosyl-L-methionine-dependent methyltran 
 172::373  1.5e-07 19.1% 0051103 00511031 1/1   nosyl-L-methionine-dependent methyltran 
 154::288    2e-07 21.1% 0050693 00506931 1/1   nosyl-L-methionine-dependent methyltran 
 168::288  2.4e-07 20.5% 0050154 00501541 1/1   nosyl-L-methionine-dependent methyltran 
 185::343  2.6e-07 20.1% 0046931 00469311 1/1   nosyl-L-methionine-dependent methyltran 
 176::325  2.9e-07 18.2% 0042682 00426821 1/1   nosyl-L-methionine-dependent methyltran 
 185::339  4.9e-07 25.8% 0050234 00502341 1/1   nosyl-L-methionine-dependent methyltran 
 196::375    5e-07 22.4% 0049915 00499151 1/1   nosyl-L-methionine-dependent methyltran 
 167::324  5.3e-07 21.0% 0052693 00526931 1/1   nosyl-L-methionine-dependent methyltran 
 196::322  8.1e-07 26.1% 0051885 00518851 1/1   nosyl-L-methionine-dependent methyltran 
 171::288  1.8e-06 22.8% 0047386 00473861 1/1   nosyl-L-methionine-dependent methyltran 
 171::339  1.8e-06 22.8% 0049671 00496711 1/1   nosyl-L-methionine-dependent methyltran 
 196::288  1.9e-06 23.7% 0050988 00509881 1/1   nosyl-L-methionine-dependent methyltran 
 181::375  2.9e-06 21.3% 0051143 00511431 1/1   nosyl-L-methionine-dependent methyltran 
 151::298  5.5e-06 22.5% 0050749 00507491 1/1   nosyl-L-methionine-dependent methyltran 
 178::310  7.2e-06 23.1% 0053087 00530871 1/1   nosyl-L-methionine-dependent methyltran 
 172::288  7.9e-06 22.1% 0052807 00528071 1/1   nosyl-L-methionine-dependent methyltran 
 196::378  8.1e-06 22.9% 0046696 00466961 1/1   nosyl-L-methionine-dependent methyltran 
 124::275    1e-05 24.0% 0047329 00473291 1/1   nosyl-L-methionine-dependent methyltran 
 181::343  1.1e-05 21.3% 0049074 00490741 1/1   nosyl-L-methionine-dependent methyltran 
 201::338  1.3e-05 28.1% 0043085 00430851 1/1   nosyl-L-methionine-dependent methyltran 
 142::323  1.5e-05 19.4% 0044689 00446891 1/1   nosyl-L-methionine-dependent methyltran 
 140::362  1.6e-05 24.5% 0047580 00475801 1/1   nosyl-L-methionine-dependent methyltran 
 142::310  1.6e-05 23.8% 0050919 00509191 1/1   nosyl-L-methionine-dependent methyltran 
 196::327  1.6e-05 24.3% 0047471 00474711 1/1   nosyl-L-methionine-dependent methyltran 
 144::255  2.4e-05 17.0% 0051840 00518401 1/1   nosyl-L-methionine-dependent methyltran 
 154::275  2.4e-05 24.2% 0051657 00516571 1/1   nosyl-L-methionine-dependent methyltran 
 140::285  4.2e-05 20.0% 0052182 00521821 1/1   nosyl-L-methionine-dependent methyltran 
 183::288  4.5e-05 20.8% 0047919 00479191 1/1   nosyl-L-methionine-dependent methyltran 
 152::344  4.7e-05 19.4% 0041326 00413261 1/1   nosyl-L-methionine-dependent methyltran 
 148::323  6.3e-05 21.0% 0036610 00366101 1/1   nosyl-L-methionine-dependent methyltran 
 201::373  7.3e-05 22.0% 0041444 00414441 1/1   nosyl-L-methionine-dependent methyltran 
 168::340   0.0001 21.1% 0045109 00451091 1/1   nosyl-L-methionine-dependent methyltran 
 144::375  0.00016 23.4% 0049885 00498851 1/1   nosyl-L-methionine-dependent methyltran 
 157::329  0.00025 17.3% 0048524 00485241 1/1   nosyl-L-methionine-dependent methyltran 
 181::274  0.00028 25.6% 0051617 00516171 1/1   nosyl-L-methionine-dependent methyltran 
 184::288  0.00032 21.0% 0050762 00507621 1/1   nosyl-L-methionine-dependent methyltran 
 165::324  0.00036 21.3% 0052739 00527391 1/1   nosyl-L-methionine-dependent methyltran 
 141::274  0.00061 22.1% 0041593 00415931 1/1   nosyl-L-methionine-dependent methyltran 
 183::337  0.00065 26.8% 0052510 00525101 1/1   nosyl-L-methionine-dependent methyltran 
   1::379


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNLYGIEIDDLLYKHFLEFLSDAEIDSLFRSITTPPPRYYIRVNTLKISPRELVKRLNSRGLAVYRDEYI
00494421   1/1  -------lpgllidrliqllg.eelealleallealp.lllrvntlkisldellelleglgie.......
00474651   1/1  -----leddllplliryslpdwlvellldllge.eleallealllplpl.dlrvntlkisleellellek
00519441   1/1  -----------------------------------slprwlvinllkllgeellealleallellplvlr
00518231   1/1  --------idcallaerlnkalellkdllkklevlrlilregdglpglavdrygdwlvvlllealgeeel
00519301   1/1  -------vllslfaerlvealkllkklllkglvnayrlvlgegdllrglavdrypdwlvvlllsalgeee
00507451   1/1  --------llvlllllllalnkalkllrdllrklglpayrlvlgegdllrglavdrygdwlvvlllselg
00518101   1/1  ----------------------------------------------------------------------
00512611   1/1  ---------------------------ellealnrklpltlrvntlkisreeilkhy.dlagkvydlfyi
00391281   1/1  ----------------------------------------------------------------------
00431061   1/1  ----------------------------------------------------------------------
00525411   1/1  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00426441   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00523381   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00495491   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00527491   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00531101   1/1  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00506931   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00526931   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00485241   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00527391   1/1  ----------------------------------------------------------------------
00415931   1/1  ----------------------------------------------------------------------
00525101   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DDALWVPVEGPFKIPTAKKVVVVDKKAAESVMLGADLYAPAVIKTDRVNIGDEVNIVSDNGRVVALGVAV
00494421   1/1  ......................................................................
00474651   1/1  l.....................................................................
00519441   1/1  vn...................................................................e
00518231   1/1  eelleallellp..elrvnllkisredlleelldelielllger..........................
00519301   1/1  lealleallellp..dlrvnllkisreeklllrreeilpllpetlleeflglrfk...............
00507451   1/1  leelealleallellppidlrvnklkisreel......................................
00518101   1/1  ----------------plgrvvvddgavkavlkGasllapgvvsvdgdiekgdvVavvdekgellAvGla
00512611   1/1  vpr...................................................................
00391281   1/1  ----------------plkrVvvddgaveailnGadlfapgvldadggiragdeVvvvtedgellavGra
00431061   1/1  -----------------lgrvvvddgaveailnGasllapgilsvdgfkkgdvvlvvsekgeliAvGlal
00525411   1/1  -----------------lgrvvvddgavkallsGasllapGvvsvdgdfergdvVavvdedgellAvGla
00465681   1/1  ----------------------------------------------------------------------
00426441   1/1  ----------------llgrvvvddgaveallnGasLlapgvvsvdgdfkkgdvVavvsedgeliAvGla
00495321   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00523381   1/1  -----------------lgrlvvddgAvkallggasLlapGvvsvegdfekgdvvavvdeggellvAvGl
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00495491   1/1  ------------------kkvvvkdgaekallyGnnllkaGilrisediekgdgvvvlslkdeplGfGla
00415801   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00527491   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00518841   1/1  ---------------------------------------------dlikegdlvllllsrgnlllvllkl
00526181   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00531101   1/1  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00506931   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00526931   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00473291   1/1  -----------------------------------------------------vkllkegdrvllelgrp
00490741   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00475801   1/1  ---------------------------------------------------------------------m
00509191   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00521821   1/1  ---------------------------------------------------------------------d
00479191   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00485241   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00527391   1/1  ----------------------------------------------------------------------
00415931   1/1  ----------------------------------------------------------------------
00525101   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           MDSDEALKARRGLYIKVEKSLYRTPKLRNLPEYAEGLFYSQSLPAILVGHIARRITQTDAVDLNSAPGGK
00494421   1/1  ........lrllpllplayilgerlefallpgfktglfltqrevsellaelldlkpgerVLDlgcGtGgl
00474651   1/1  ..............gvvleaydllgdpleyllglre.fyslplfkdglvltqdavsellvelldpkpgdr
00519441   1/1  llaelgielerdelgppllyllggvefadlplyktgvfitqdeasallaelldlkpgdrVLDlgaGsGgl
00518231   1/1  ..........................................................dllgelyenglr
00519301   1/1  ......................................................................
00507451   1/1  ....................................................................ge
00518101   1/1  lmsseeilkikkgvaveilhv-------------------------------------------------
00512611   1/1  ...........gefllldptledsv.....lifkrgteilqpadlalilellglkpgdrvLDiGcGsGgl
00391281   1/1  llsgeellelkkgiavkvrrvl------------------------------------------------
00431061   1/1  lsseellllkggiaveivlll-------------------------------------------------
00525411   1/1  lysseeilkikggvaveilhv-------------------------------------------------
00465681   1/1  ------------------------------------------------------gyvsrgalklqellek
00426441   1/1  lmsseellkikggkaveilhvlgd..elwhrd--------------------------------------
00495321   1/1  -------------------------tigellrealalleeagldlldaelllllllgldrlrlllllllp
00484901   1/1  --------------------------------lllldkllkllkpgdlvllllannlllpltlrvnklkl
00523381   1/1  alysseellkilglkskgiavilghllgd-----------------------------------------
00526491   1/1  ------------------------------ddlyddglsliqrellelllelldlllkpgkrvLDiGcGt
00479231   1/1  -----------------------------efyddyalsfdeglrptqeellelllellglkpgkrvLDlG
00379821   1/1  melveklkedgvivvedvldafrlvsknlflgervygegvvkpqdegatiwaphrsrlaaklaeilelld
00445501   1/1  ------------------------------------------------------------LDlGCGtGgl
00479451   1/1  -----------------------------------------------------------etlgellklrl
00408291   1/1  ------------------------------------vlipfehqevlleellellklkpgkrvLDlGcGt
00495491   1/1  alsteelrkldpglvvvirq--------------------------------------------------
00415801   1/1  -------------------------------------------------------------------Gll
00491221   1/1  -------------------------------mstvplselskklaeeffydlaadfydllldglfpsqre
00527491   1/1  ------------------------------------------------------------lDlgaGiGil
00467441   1/1  ---------------------ikrlvvllvlkglllsrlladalilvprhydlgedlygeelakvyddla
00505191   1/1  ------------------------------------------------------------lDlgcGtGgh
00463541   1/1  ---------renlvdnlaehydllnevleallkvprelflpevplrelayedeflpitlevgegllisqp
00488051   1/1  ------------------------------------------------------------LDlGcGsGgl
00518841   1/1  lneggvlntrygvlkhddligklygsfldsskgysvallrpapedltll.lkrgtqivqpkdialilell
00526181   1/1  ----------------------------lqeitedllellfnallllienlldgaldalleilpellgll
00484381   1/1  ----------------------------------------seildglvivgkydlskdlfeeflgdydlv
00531101   1/1  ----------------------fanrlnkalklrkkllkklgldayrlfdglpglvvdrygdvlviqvts
00531071   1/1  ---------------------GplriilgefrglklkvdpgvlirpttdrlrelllelladllkgkrvLD
00514491   1/1  ------------------------------GadeyfefgpryiqepllelllelldlllkpgkrvLDiGc
00494741   1/1  -----------------------------------kngikdeilldyilsrprgepldelldeyedyalk
00511031   1/1  -------------------------------kllelldldidllklsllklkkinklyknlknlilknts
00506931   1/1  -------------llriiggkfrgrkllvpp.......gprptterlrealfnllllllleggrvLDlga
00501541   1/1  ---------------------------dvaeyfddiaavydgfaeglreaaeallelllellppgkrvLD
00469311   1/1  --------------------------------------------erlfdeyaefydlanglglrprqeal
00426821   1/1  -----------------------------------qnfltdpeilekilelldlkegdrvLdiGcGtGal
00502341   1/1  --------------------------------------------alklelllellg.lkpgkrvLDiGcG
00499151   1/1  -------------------------------------------------------Llvlgllielltpgl
00526931   1/1  --------------------------lriiaGqfrgrkldvpdglitrpttdrvrealfnilapllegkr
00518851   1/1  -------------------------------------------------------eldgqlldlllklik
00473861   1/1  ------------------------------melfdevaeryddfadglspgqdrllelllellaellkpg
00496711   1/1  ------------------------------nsvsglfdsiashydllndlyellldedyfysygyfddyg
00509881   1/1  -------------------------------------------------------kalldillwliells
00511431   1/1  ----------------------------------------qrellelllellg.lkpgkrvLDiGcGtGg
00507491   1/1  ----------egeplriilgkleglklkldpgqa...fltprpvtellvdallelgllkgkrvlDlGaGt
00530871   1/1  -------------------------------------fyTPreivellvelldpkpggrvlDpgcGsGgf
00528071   1/1  -------------------------------fdsyayfydalnllqlrprtea.lleallellglkpgkr
00466961   1/1  -------------------------------------------------------dlsndlyelyldlyd
00473291   1/1  lmllellregglldtrlgiepledllgvprglfldlavgylvlilrpltedlveafgrgtqitqpavaal
00490741   1/1  ----------------------------------------ledllrayllllpellllleslenladhld
00430851   1/1  ------------------------------------------------------------LDiGcGsGyl
00446891   1/1  -Mveklirkhyildeevleaflkvprelfvpeplyslayfdglealkflgqnflsapellalllelldlk
00475801   1/1  edleearkklvelllrnngilnlrvldalervprehfvpsllgylafldlplafgegvlisqpellalll
00509191   1/1  -klleleedvrslfldyaelydgdnll..leelgdgvmraqeralmallallglrpggrVLDvGcGtGgl
00474711   1/1  -------------------------------------------------------ldgwfteilwpglrl
00518401   1/1  ---qvmlklikkqikeypqdklvripekaslyllvlealltglnllqrllaafllelldlfkgkrvLdiG
00516571   1/1  -------------pedevkelirsfydraadrydgqnrlleelgdgvmlaqerallrllallglrpggrv
00521821   1/1  iteeelleyvlrhs.fvpdpllllalrdealdvggglpilspekgalllellrllpgkrvLdiGtGtGys
00479191   1/1  ------------------------------------------Ydlgndlyellldedyfysdayyddpgd
00413261   1/1  -----------rskrvpleyilgeadfyglpldvggafltprpitellleallelgllkgkrvLDlGcGt
00366101   1/1  -------mserliklepekyillelkflglrfkvdpgvffptgldldtelllelldlkkgkrvLDlGcGt
00414441   1/1  ------------------------------------------------------------LDlGcGtGgl
00451091   1/1  ---------------------------ddlakflgqnfltdpellelilellnlkpgdtvLDiGcGtGal
00498851   1/1  ---darlllglllglslllleayldlvldeeelerllellerlaerypllksllselndrdweeaylkgl
00485241   1/1  ----------------rayelplqyitgeldfsglelhvrgyvpaliprpltellaaallrllgldpgtv
00516171   1/1  ----------------------------------------QnfltdpalldailellglkpgdrVLDiGc
00507621   1/1  -------------------------------------------veehydelaefydkllgelliprpate
00527391   1/1  ------------------------ypmriiagkfrgrkllv..ppglftrpttdrvreallnilapllpg
00415931   1/1  mevelmkilvtdpeelglvsklnekrlkaleeilsviqnvneelleailavlrrvllpsngkdfaeiaal
00525101   1/1  ------------------------------------------ladvlanvlldirksekvldlGcGtGll


                         -         -         -         +         -         -         -:280
query           TTHLAQMGIRVIAVDRSAQKIEKLRSEAARLGLDVFIDILLHDSRYLDRDFPKIKAGVALVDPPCTDIGV
00494421   1/1  tlalaklvgaagvvavDispealelarenaelngl..nvefivgDalellkllpdgkfDlillDPPysgs
00474651   1/1  VLDlGcGsGglalalaklvgpagrvvavDispealelarenakrlgl.dnveviqgDaldl..pledgkf
00519441   1/1  tlalaelvgpggrvvavDispealelarenaerlgl.dnveviqgDaldlplldllggkfDvillDpPys
00518231   1/1  flvdpdgfgtglfptqellaelllelld..pgkrvLDlGcGtGglalalaklgagrvtgvDispealela
00519301   1/1  ..vdpgvffqtglfptqelllelllell..kpgkrvLDlGcGtGglalalaklgakkvtgvDispealel
00507451   1/1  pvelllgelpeelyvqflglkfkvdpgvffrpgtellvelllelldlk.pgkrvLDlGcGtGglalalar
00518101   1/1  ----------------------------------------------------------------------
00512611   1/1  tlalarlvgpegrvtavDiseealelarenlerlglddnveviqgDaed...plpdgsfDaivsdlpdpw
00391281   1/1  ----------------------------------------------------------------------
00431061   1/1  ----------------------------------------------------------------------
00525411   1/1  ----------------------------------------------------------------------
00465681   1/1  lgllkpgervLDlGcGpGgltlvlaervgpggrvvavDlsp.mlelar...........vefiqgdardl
00426441   1/1  ----------------------------------------------------------------------
00495321   1/1  lsvlelllllellerrllgepveyllgerefyglafkvgggvftprpttelllelllellp.kpgkrvLD
00484901   1/1  trfgllnvlelsgknavahydlsndvyellldpaysdslarfgegntllqpelaelllelldlkpgkrvL
00523381   1/1  ----------------------------------------------------------------------
00526491   1/1  GglalalakllpgakvtgvDispemlelarenakelglpn.vefivgDaedlpellpdgsfDlivsnpPy
00479231   1/1  cGtGglalalaklgpkvtgvDispealelarenakelglddnvefivgDaedlp..lpdgsfDlivsdpp
00379821   1/1  lkpGdrVLDlGcGtGgltlhlaklvgpeGkvvgvDispemlelarenleklg...nvefilgDaeelpky
00445501   1/1  tlalAklgarVvgvDispealelarenaklngldn.vefivgDaeellkelpfpdgsfDvvvsDPPy...
00479451   1/1  nklikeefdlgnkfsklwldrsvydsyyfeakllglyrsraalkleelleklglkpgkrvLDlGCGtGgl
00408291   1/1  GglalalakllpgarvigvDispealelarenlkelg..dnvefiqgdaldlpellllfpdgsfDlilsD
00495491   1/1  ----------------------------------------------------------------------
00415801   1/1  aialaklgaakvtgvDispealelArenaelnglsnrvefivgdaleflp..fpdgkfDlivsNPPyggl
00491221   1/1  lldlllellglkpgkrvLDlGcGtGglalalakrgarvtgvDispemlelarenaaelglsdaddnvefi
00527491   1/1  alpaaklgakkVvaveidpeavellreNaklnglenrvevingdardllpe...ekfDvvvldppasg..
00467441   1/1  afldglrsrqeallelllellglkpgkrvLDlGcGtGglalalakllgagrvtgvDispealelarenaa
00505191   1/1  slalaerggrvigvDidpealalarerlaglgllnrvefvqgdalalp..lpdgsfDgvlldlgl-----
00463541   1/1  etlalllellglkpgkrvLDiGcGtGylalalarlggpdgrvvavDispealelarenaerlgl.dnvef
00488051   1/1  tlhlaelvgpeGkVygvDispemlelarenleelg...nvefilgDaeellklpfpdgsfDvvlsdavlh
00518841   1/1  dlkpGdrVLDiGtGsGgltlllarlvgpkGrVigvdiseemlelarenlkrlgldlhleklgyaldnvef
00526181   1/1  flldlllddellrelldllseidlseidydilgelyeyllgefagl.rfklgefytprpvtellvelllp
00484381   1/1  lafldglrsraerllelllellglkpgkrvLDlGcGtGglalalakllgagrvtgvDispealelarena
00531101   1/1  agalklkdalvdalevkgiylkvnrrllglplrvllgelpetitveenglkflvdpgsffqtglrpdtrl
00531071   1/1  lgcGtGglalalakrgakkvtgvDispealelarenaklngldednvefiqgdaldflplllldekfDli
00514491   1/1  GtGglalalakllpgakvtgvDispemlelarenakelgl.pnvefivgdaedlpellpdgsfDlivsnp
00494741   1/1  fglglliiqpellalllelldlkpgkrvLDiGcGtGglalalakllppgakvtgvDispealelarenak
00511031   1/1  nvskeeiakfydlvadffdevaayydglfgdllslrpaqeellelllellplkpgkrvLDiGcGtGglal
00506931   1/1  GsGalaleaasrgaevvavDidpeavalarenaerlglenrveviqgdafellaalpgesfDlvvldPPy
00501541   1/1  iGcGtGglalalakrgarvtgvDispemlelareraaelgl..nvefvvgDaedlp..fpdgsfDlvvsn
00469311   1/1  lelllellplkpgkrvLDlGcGtGglalalaklgpkrvtgvDisp.mlelarenaaenglpnrvefivgD
00426821   1/1  tlelakrggkvtaieideemlelakenlkelg.....nvefiqgDalklpfpdgkfDlivsNpPy..nis
00502341   1/1  tGglalalakrgarvtgvDispemlelareraaelglpn.vefvvgDaedlp..fpdgsfDlvvsnavlh
00499151   1/1  rlllkvdelllserskyqeirvyelgddgrvllldgllqgsslderqrallllllallglkpgkrvLDiG
00526931   1/1  vLDlfaGsGalgleaasrgaakvvavdispealelakenaalnglenrvevirgdalellkallkegekf
00518851   1/1  eklkknlglnldllplgegqyieelwpglalslkvdevlhekkskyqiiriydlgndgrrlfldggvqys
00473861   1/1  krvLDiGcGtGglalalakllgepgarvtgvDispemlelareraaelglsdnvefvvgDaedlp..lpd
00496711   1/1  lglrpaqeallelllellglkpgkrvLDiGcGtGglalalakalgarvtgvDispemlelarenaaelgl
00509881   1/1  lglalslkidklleeekskyqiiriydlgnfgyelfldgrllysrldeaqytelllllllldlkpgkrvL
00511431   1/1  lalalakrgprvtgvDispemlelareraaelglpn.vefvvgDaedlp..fpdgsfDlvvsnavlhhl.
00507491   1/1  GalslalakrgakkvvavDidpealelarenaelngl..nveviqgdalelp....g.kfDlvvsNPPyi
00530871   1/1  llalaerllpgarvvgvDidpealelaren..........eivvgDalell...pdesfDliiaNPPygg
00528071   1/1  vLDlGcGtGglalalakrgakrvtgvDisp.mlelarenaaenglpnrvefivgDaedl..plpdgsfDl
00466961   1/1  lyssaydllgdrpltdalleallellglkpgkrvLDlGcGtGglalalakrgakrvtgvDisp.mlelar
00473291   1/1  llellglkpGarVLDlGcGtGaltlalaravgpggrvvavDispealelarenlaraglalpdnv-----
00490741   1/1  lgnppfelllgeeffeyfakvyelydafndglrpatrlllelllellglkpgkrvLDiGcGtGglalala
00430851   1/1  tlalarlvpelgkdpggrvvgvDispealelarenlerlgldlllpdnvefivgdaedlp..fpdgsfDl
00446891   1/1  pgkrVLDiGcGtGyltlllaklggkvtgvDiseemlelarenlkeng...nvefivgDaeel..pfpdes
00475801   1/1  elldlkpgdrvLDiGcGtGylalalaklvggrvtavdispealelarenaerlgl.dnvevilgdaeell
00509191   1/1  alalaeagpeevtgvDispemlerareraaelg..pnvrvlvgdaeellpplpdgsfDavlsDppgs...
00474711   1/1  llkldellheekskyqiiriydlgndgrvllldglvlgsrpdeaqerllllllallplkpgkrvLDiGcG
00518401   1/1  aGtGllllalaellppgaevtgiDidpdalevarknlkrlglpkr-------------------------
00516571   1/1  LdvGcGtGllalalaeagpaevtgvDispemlerareraaeag..pnvrvlvgdaedllpplpdg-----
00521821   1/1  alalaralppgarvvavdispealalarenleaaGledrvtvilgdaedllpqllaplpdgkfDliflda
00479191   1/1  llrpaqerllelllellglkpgkrvLDiGcGtGglalalakalgarvtgvDispemlelareraaelglp
00413261   1/1  GilaialaklGaakvtavDispealelarena.....g.nvefivgdaeelp....g.kfDlivsNPPyv
00366101   1/1  GilaialakrgakvtgvDispealelakenaklngldnrkvefiqgdaed...plpdgkfDlivsnppyl
00414441   1/1  alalaravgarvtgvDispemlelareraeelglpdnvefvvgDaedl...fpdgsfDlvvsngvlhhlp
00451091   1/1  tlalaklgpkvtgvdiseemlelakenlkeng...nvtfihgDalel..pfpdgkfDlivsNpPynista
00498851   1/1  rpfrgldflvipavldprpdgerlvldpglffgtglhpttelllellakllkpgdrVLDlGcGtGtlaia
00485241   1/1  lDpgCGsGtllieaalaarrpaarviGvDidpaalelArrnlallgladllllesasellsslleklsll
00516171   1/1  GtGaltlalakrgarvtgvDispemlelareraaengladnvefiqgDaedl..plpd..fDlv------
00507621   1/1  ellelllellglkpgkrvLDlGCGtGrlalalakrgpevtgvDispemlelArerakengl..nvefiqg
00527391   1/1  arvLDlgaGsGalgleaasrgaarvtaveispealelarenaallgldn.veviqgdaleflpel.gekf
00415931   1/1  ydlyndsyesfyqlnagqallld.egmlipraltemlldlvysltvpdarklnhyisfsdevyg------
00525101   1/1  lialaelgarkvyavDlsplalelcrknlallglddrvkvvhgd..lldlldleessfDlilldppy...


                         -         *         -         -         -         -         +:350
query           RPKIYHKVTFEAAKTLARYQIQFLKTALKIAPYVIYSTCTLTYIENEGVIEKAGAEIVDAGIEIGAPGWG
00494421   1/1  gtlrrvpdieprlalkglldllelqrrllelalrlLkpgGrlvystcsllpeeneavveaflekgpg..l
00474651   1/1  DlilsdpPysglgtirrdpdikprlalsgglellelqrelleealrlLkpgGrlvystcsllpeeneavv
00519441   1/1  gsgtlrrdpdvrwelslalkgladllalqrelleealrLkpgGrlvystcsllpeeneavvaaalerlpd
00518231   1/1  renaalngldnrvefivgDaedllkellkpdgsfDlivsDPPysgsgd..........sgvlehledlee
00519301   1/1  arenaklngleddnvefiqgDaedllkelpfedgkfDlivsDPPysglgt......sgvlehlp.dlekl
00507451   1/1  pgakvtgvDispealelarenaklngldn.vefiqgDaeeflpelpfedgkfDlivsDPPysgksesgvl
00518101   1/1  ----------------------------------------------------------------------
00512611   1/1  ........................elleelarlLkpGGrlvlstptieqleellelleeaGfevveveel
00391281   1/1  ----------------------------------------------------------------------
00431061   1/1  ----------------------------------------------------------------------
00525411   1/1  ----------------------------------------------------------------------
00465681   1/1  ..plldlllellpdgsfDlvlsdaplshlgdlrr........dlarlaalqlalleealrlLkpgGrlvl
00426441   1/1  ----------------------------------------------------------------------
00495321   1/1  lGcGtGglalalakllpgarvtgvDispealelarenaalngl.dnvefvqgDald...plpdgsfDliv
00484901   1/1  DiGcGtGglalalakllgpdarvtgvDispealelArenakrlglddnvefivgDaed...plpdgsfDl
00523381   1/1  ----------------------------------------------------------------------
00526491   1/1  pwpgvlhhlpdellekllk---------------------------------------------------
00479231   1/1  lhhlpd...................llkellrlLkpGGrlvlstpnpegleellellkklgf.lvelill
00379821   1/1  llpdgsfDvilsdaplsh..................lpdealeealrvLkpGGrlvisdfsrsidspeen
00445501   1/1  ........sglsgvlhhlpdpelkrivyvscnpellaelarlLkpGGrlvlstg----------------
00479451   1/1  alylakrypgakvtgvDispemlelaren.krlgl.dnvefiqgvda....lp-----------------
00408291   1/1  pPysslgl.........lifvlhhledleefleealrvLkpgGrlvlvtfss...ledeivkkllkelgk
00495491   1/1  ----------------------------------------------------------------------
00415801   1/1  s.......ellievlhhlpdlaldggkdglealleeaarlLkpgGrlvistgprtleel-----------
00491221   1/1  vgDaedl..plpellledgsfDlvvsnfavlhhlptgrrdpedlea...................llrel
00527491   1/1  .....................lellkaalkllkpggivyvscnpatlardellleelgyrleklgvvdmf
00467441   1/1  ..glpn.vefivgDaedplpdlleegsfDlvvsdlphvpdp.....................ealleeaa
00505191   1/1  ----------------------------------------------------------------------
00463541   1/1  ilgdaedll..fedgsfDlvvsdapleh......................lleellrlLkpGGr------
00488051   1/1  .....pdp.............eaaleealrvLkpGGrlvisdftreq....dsplepfeteeelvellee
00518841   1/1  ilgdaeellkllpdgsfDavfldlpd.....................peealeellr-------------
00526181   1/1  klgdlkglrvLDpgCGsGgllialakrlpn----------------------------------------
00484381   1/1  krlg...nvefivgDaedlldlplpdgsfDlvvsdlphlpdp.....................eallrea
00531101   1/1  lrealaaalaglakgkrvLDlgcGtGglslaaakagaeVtgvDispealelareNaalng----------
00531071   1/1  vsnppy..............glegledlekllkea.rlLkpgGilvleinpetleellellkelg-----
00514491   1/1  Pyp.sgvlhhlpdpl..........lqeellkelarvLkpGGrlvl------------------------
00494741   1/1  englpnrvefivgdaedflpfllaeglldgsfDlivsdalh...pdlpk................lleel
00511031   1/1  alakrlgarvtgvDispemlelarenaaelgl...vefivgDaedlp..fpdgsfDlvvsngvlhhlpdp
00506931   1/1  gldglell--------------------------------------------------------------
00501541   1/1  avlhhlpd--------------------------------------------------------------
00469311   1/1  aedlleplpd..fDlvvsnPpggvlhhlpd.................leallrelarvLkPGG-------
00426821   1/1  savlhhledlekarrltlmlqleealrlLkpgGrlvilvqnltlv-------------------------
00502341   1/1  hlpdpe...................allrelarvLkPGGrlvlstpnlpdlellrllla-----------
00499151   1/1  cGtGglalalakrpegarvtgvDispealelarenlaelglgllddpnvefivgDaedflpfl..dgsfD
00526931   1/1  DlvvlDPPyfa...............glllyllllllalkllkp--------------------------
00518851   1/1  rlderqleelllllalldlkpgkrvLDlGcGtGglalalakr----------------------------
00473861   1/1  ..fDlvvs--------------------------------------------------------------
00496711   1/1  pnrvefvvgDaedl.....dgsfDlvvsnavlhhlp..vedpeallrelarvLkPGGrl-----------
00509881   1/1  DiGcGtGg--------------------------------------------------------------
00511431   1/1  ..pdp................eallrelarvLkPGGrlvlstpnrpdleelrelldllerlllpgh....
00507491   1/1  itskillklllklepela----------------------------------------------------
00530871   1/1  sgdldrlldellkrlydelalalsgvlgll----------------------------------------
00528071   1/1  vvsnplpf--------------------------------------------------------------
00466961   1/1  enaaenglpnrvefivgDaedl..plpdgsfDlvvsnpsgvlhhlpd.................e.leal
00473291   1/1  ----------------------------------------------------------------------
00490741   1/1  kalPgarvtgvDi.pemlelarenaaelglspnvefvvgDaed...plpd.sfDlvvsngvlh-------
00430851   1/1  vvsnavlhhl......................leellrlLkpGGrlvlsvpnreglee------------
00446891   1/1  fDlivsnaplhhl......................leellrlL---------------------------
00475801   1/1  ..fedgsfDlvvsdapl......................phlleellrlLkpGGrlvlvvgtleg.....
00509191   1/1  ..........sevlhhvp.dleaflaeaar----------------------------------------
00474711   1/1  tGglalalakrgpdarvtgvDispealelarenlalnglelglpnve-----------------------
00518401   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00521821   1/1  plehl-----------------------------------------------------------------
00479191   1/1  nrvefvvg--------------------------------------------------------------
00413261   1/1  plsd.illlevldleplsallehlddleelleeaarlLkpgGrlvlstplptq......leell------
00366101   1/1  lgledlek................lleeaarlLkpgGilllst---------------------------
00414441   1/1  .dpeallrelarvLkpGGrlvlseptleg.eepeelldfilryifpggflsleellalleeaGfevveve
00451091   1/1  vlehlpdleelrrl..vlmlqleealrlLkpgGrlvlvvgtledveillkvppgaffppp----------
00498851   1/1  laklgarvtgvDispealelArenaarngldn.vefvqgdaedlp....dgsfDlvvsnppl........
00485241   1/1  dlllaldlleelllgelktlrvevvqgDaldalalllplpdgsfDlvvt---------------------
00516171   1/1  ----------------------------------------------------------------------
00507621   1/1  Daedlp..--------------------------------------------------------------
00527391   1/1  dliflDPPy...............agglldlllllllalrllkp--------------------------
00415931   1/1  ----------------------------------------------------------------------
00525101   1/1  ...........sllilelldvllsaa.rvLkpgGlvvvvdpdvlvladeledlvkkl-------------


                         -         -         -         -         *         -         -:420
query           CRECRRFLPHVHNTPGFFIAVLRGARKEP-----------------------------------------
00494421   1/1  elvdllvllpgglrllPhldgtdg----------------------------------------------
00474651   1/1  aaflkelgfelvplelllpgllrla---------------------------------------------
00519441   1/1  lfelvdlrlllpdlpirllltlegg---------------------------------------------
00518231   1/1  lleeaarlLkpGGrlvlvtcsplpeene------------------------------------------
00519301   1/1  leeaarlLkpGGrlvlstpsi-------------------------------------------------
00507451   1/1  ehlpd...--------------------------------------------------------------
00518101   1/1  ----------------------------------------------------------------------
00512611   1/1  lpryartletwlrplprrlghdg-----------------------------------------------
00391281   1/1  ----------------------------------------------------------------------
00431061   1/1  ----------------------------------------------------------------------
00525411   1/1  ----------------------------------------------------------------------
00465681   1/1  stcs...eeneevll-------------------------------------------------------
00426441   1/1  ----------------------------------------------------------------------
00495321   1/1  sNPPysg---------------------------------------------------------------
00484901   1/1  ivsdppdpe..............-----------------------------------------------
00523381   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  yifpyvplvellrllglldv.-------------------------------------------------
00379821   1/1  eevf........eellklgfe-------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00408291   1/1  lvlvvkgpllpsl...eeleellrk---------------------------------------------
00495491   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00491221   1/1  arvLkPGGrlvlstpnpddleelle---------------------------------------------
00527491   1/1  phth------------------------------------------------------------------
00467441   1/1  rlLkpGGrlvlstpsrteeeleel----------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00488051   1/1  .gfelveivellpsrkdhaevv------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00484381   1/1  arlLkpGGrlvls---------------------------------------------------------
00531101   1/1  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00494741   1/1  arlLkpGGrlvlsdplrpgeevll----------------------------------------------
00511031   1/1  elk.................kll-----------------------------------------------
00506931   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00499151   1/1  livsdpplhhlpdpel.........---------------------------------------------
00526931   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00511431   1/1  .............grflsleeleal---------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00466961   1/1  lrelarvLkPGGrlvlstps........------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00475801   1/1  .....leellel----------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00414441   1/1  dltagvvevlrlhyaltlrlwle-----------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00498851   1/1  ..........ehlpd.llaeaarlL---------------------------------------------
00485241   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00527391   1/1  ----------------------------------------------------------------------
00415931   1/1  ----------------------------------------------------------------------
00525101   1/1  ----------------------------------------------------------------------