[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL63125.1


[Show Plain Result]

## Summary of Sequence Search
   1::471
  17::273  2.3e-35 29.5% 0048596 00485961 1/1   al SAM enzymes                          
   7::316  2.1e-18 23.3% 0043105 00431051 1/1   al SAM enzymes                          
 404::457  5.5e-08 31.5% 0051252 00512521 1/1   CoA N-acyltransferases (Nat)            
 404::457  4.5e-07 25.9% 0050223 00502231 1/1   CoA N-acyltransferases (Nat)            
 404::456    5e-07 26.4% 0050940 00509401 1/1   CoA N-acyltransferases (Nat)            
 404::461    1e-06 25.9% 0048876 00488761 1/1   CoA N-acyltransferases (Nat)            
 404::458  1.8e-06 27.8% 0047280 00472801 1/1   CoA N-acyltransferases (Nat)            
 404::457  3.4e-06 31.5% 0051437 00514371 1/1   CoA N-acyltransferases (Nat)            
 404::458  3.8e-06 31.5% 0048084 00480841 1/1   CoA N-acyltransferases (Nat)            
 404::457    4e-06 29.6% 0051248 00512481 1/1   CoA N-acyltransferases (Nat)            
 404::457  4.3e-06 35.2% 0052829 00528291 1/1   CoA N-acyltransferases (Nat)            
 404::457  4.8e-06 31.5% 0046158 00461581 1/1   CoA N-acyltransferases (Nat)            
 404::455  5.7e-06 26.9% 0052040 00520401 1/1   CoA N-acyltransferases (Nat)            
 404::459  6.5e-06 28.6% 0049311 00493111 1/1   CoA N-acyltransferases (Nat)            
 404::458  6.7e-06 30.9% 0051915 00519151 1/1   CoA N-acyltransferases (Nat)            
 404::453  7.1e-06 28.0% 0049032 00490321 1/1   CoA N-acyltransferases (Nat)            
 404::458  7.6e-06 27.3% 0049641 00496411 1/1   CoA N-acyltransferases (Nat)            
 404::457  1.2e-05 33.3% 0052704 00527041 1/1   CoA N-acyltransferases (Nat)            
 404::458  1.6e-05 30.9% 0051830 00518301 1/1   CoA N-acyltransferases (Nat)            
 404::458  1.6e-05 29.1% 0052858 00528581 1/1   CoA N-acyltransferases (Nat)            
 404::453  1.8e-05 28.0% 0051420 00514201 1/1   CoA N-acyltransferases (Nat)            
 404::453  1.9e-05 28.0% 0049804 00498041 1/1   CoA N-acyltransferases (Nat)            
 404::454    2e-05 31.4% 0048674 00486741 1/1   CoA N-acyltransferases (Nat)            
 404::458    2e-05 25.5% 0052347 00523471 1/1   CoA N-acyltransferases (Nat)            
 404::454  3.1e-05 27.5% 0051493 00514931 1/1   CoA N-acyltransferases (Nat)            
 404::457  4.6e-05 29.6% 0051375 00513751 1/1   CoA N-acyltransferases (Nat)            
 404::452    5e-05 28.6% 0051303 00513031 1/1   CoA N-acyltransferases (Nat)            
 404::454  5.9e-05 27.5% 0046177 00461771 1/1   CoA N-acyltransferases (Nat)            
 404::457  6.6e-05 29.6% 0053292 00532921 1/1   CoA N-acyltransferases (Nat)            
 404::452  7.1e-05 30.6% 0049884 00498841 1/1   CoA N-acyltransferases (Nat)            
 404::457    8e-05 34.0% 0046988 00469881 1/1   CoA N-acyltransferases (Nat)            
 404::457   0.0001 27.8% 0051751 00517511 1/1   CoA N-acyltransferases (Nat)            
 404::453  0.00011 26.0% 0051232 00512321 1/1   CoA N-acyltransferases (Nat)            
 404::453  0.00013 28.6% 0045896 00458961 1/1   CoA N-acyltransferases (Nat)            
 404::450  0.00013 27.7% 0051421 00514211 1/1   CoA N-acyltransferases (Nat)            
 404::458  0.00013 27.3% 0052664 00526641 1/1   CoA N-acyltransferases (Nat)            
 404::452  0.00014 29.8% 0043128 00431281 1/1   CoA N-acyltransferases (Nat)            
 404::458  0.00014 27.8% 0051492 00514921 1/1   CoA N-acyltransferases (Nat)            
 404::459  0.00016 28.6% 0050185 00501851 1/1   CoA N-acyltransferases (Nat)            
 404::453  0.00023 28.0% 0048174 00481741 1/1   CoA N-acyltransferases (Nat)            
 404::451  0.00024 27.1% 0051377 00513771 1/1   CoA N-acyltransferases (Nat)            
 404::454  0.00032 28.0% 0050733 00507331 1/1   CoA N-acyltransferases (Nat)            
 404::459  0.00042 33.9% 0053076 00530761 1/1   CoA N-acyltransferases (Nat)            
 404::450  0.00085 29.8% 0052874 00528741 1/1   CoA N-acyltransferases (Nat)            
   1::471


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASGVHVVALMTQPFPCPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPS
00485961   1/1  ----------------vvtplrlglidlydlpgprytsyptapelselfgpkvyklplaeifsdplslyi
00431051   1/1  ------gegltleealallrlpllellceaakcprrdrfgrrvtltllisvktngCplrCkyCavsagsg
00512521   1/1  ----------------------------------------------------------------------
00502231   1/1  ----------------------------------------------------------------------
00509401   1/1  ----------------------------------------------------------------------
00488761   1/1  ----------------------------------------------------------------------
00472801   1/1  ----------------------------------------------------------------------
00514371   1/1  ----------------------------------------------------------------------
00480841   1/1  ----------------------------------------------------------------------
00512481   1/1  ----------------------------------------------------------------------
00528291   1/1  ----------------------------------------------------------------------
00461581   1/1  ----------------------------------------------------------------------
00520401   1/1  ----------------------------------------------------------------------
00493111   1/1  ----------------------------------------------------------------------
00519151   1/1  ----------------------------------------------------------------------
00490321   1/1  ----------------------------------------------------------------------
00496411   1/1  ----------------------------------------------------------------------
00527041   1/1  ----------------------------------------------------------------------
00518301   1/1  ----------------------------------------------------------------------
00528581   1/1  ----------------------------------------------------------------------
00514201   1/1  ----------------------------------------------------------------------
00498041   1/1  ----------------------------------------------------------------------
00486741   1/1  ----------------------------------------------------------------------
00523471   1/1  ----------------------------------------------------------------------
00514931   1/1  ----------------------------------------------------------------------
00513751   1/1  ----------------------------------------------------------------------
00513031   1/1  ----------------------------------------------------------------------
00461771   1/1  ----------------------------------------------------------------------
00532921   1/1  ----------------------------------------------------------------------
00498841   1/1  ----------------------------------------------------------------------
00469881   1/1  ----------------------------------------------------------------------
00517511   1/1  ----------------------------------------------------------------------
00512321   1/1  ----------------------------------------------------------------------
00458961   1/1  ----------------------------------------------------------------------
00514211   1/1  ----------------------------------------------------------------------
00526641   1/1  ----------------------------------------------------------------------
00431281   1/1  ----------------------------------------------------------------------
00514921   1/1  ----------------------------------------------------------------------
00501851   1/1  ----------------------------------------------------------------------
00481741   1/1  ----------------------------------------------------------------------
00513771   1/1  ----------------------------------------------------------------------
00507331   1/1  ----------------------------------------------------------------------
00530761   1/1  ----------------------------------------------------------------------
00528741   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KIEAVIMGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALTVETRPD
00485961   1/1  hipgCpnrCtyC....dfpsivtkrgklrsr.......yleallkeiellaallggrgvkeiylgGgtpt
00431051   1/1  tgl..........kkprllspeeileeakaaaelGvk....rvvltggepllrpd..gaeyllelirai.
00512521   1/1  ----------------------------------------------------------------------
00502231   1/1  ----------------------------------------------------------------------
00509401   1/1  ----------------------------------------------------------------------
00488761   1/1  ----------------------------------------------------------------------
00472801   1/1  ----------------------------------------------------------------------
00514371   1/1  ----------------------------------------------------------------------
00480841   1/1  ----------------------------------------------------------------------
00512481   1/1  ----------------------------------------------------------------------
00528291   1/1  ----------------------------------------------------------------------
00461581   1/1  ----------------------------------------------------------------------
00520401   1/1  ----------------------------------------------------------------------
00493111   1/1  ----------------------------------------------------------------------
00519151   1/1  ----------------------------------------------------------------------
00490321   1/1  ----------------------------------------------------------------------
00496411   1/1  ----------------------------------------------------------------------
00527041   1/1  ----------------------------------------------------------------------
00518301   1/1  ----------------------------------------------------------------------
00528581   1/1  ----------------------------------------------------------------------
00514201   1/1  ----------------------------------------------------------------------
00498041   1/1  ----------------------------------------------------------------------
00486741   1/1  ----------------------------------------------------------------------
00523471   1/1  ----------------------------------------------------------------------
00514931   1/1  ----------------------------------------------------------------------
00513751   1/1  ----------------------------------------------------------------------
00513031   1/1  ----------------------------------------------------------------------
00461771   1/1  ----------------------------------------------------------------------
00532921   1/1  ----------------------------------------------------------------------
00498841   1/1  ----------------------------------------------------------------------
00469881   1/1  ----------------------------------------------------------------------
00517511   1/1  ----------------------------------------------------------------------
00512321   1/1  ----------------------------------------------------------------------
00458961   1/1  ----------------------------------------------------------------------
00514211   1/1  ----------------------------------------------------------------------
00526641   1/1  ----------------------------------------------------------------------
00431281   1/1  ----------------------------------------------------------------------
00514921   1/1  ----------------------------------------------------------------------
00501851   1/1  ----------------------------------------------------------------------
00481741   1/1  ----------------------------------------------------------------------
00513771   1/1  ----------------------------------------------------------------------
00507331   1/1  ----------------------------------------------------------------------
00530761   1/1  ----------------------------------------------------------------------
00528741   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAYKVCYHVMPGLPGSDPD
00485961   1/1  llgpdqleellealrelfpldg.........................dveitletrpdtlddelldllke
00431051   1/1  ..........................kel.gleitttnglldeelleelkeaGldrvnlslet.dpelyk
00512521   1/1  ----------------------------------------------------------------------
00502231   1/1  ----------------------------------------------------------------------
00509401   1/1  ----------------------------------------------------------------------
00488761   1/1  ----------------------------------------------------------------------
00472801   1/1  ----------------------------------------------------------------------
00514371   1/1  ----------------------------------------------------------------------
00480841   1/1  ----------------------------------------------------------------------
00512481   1/1  ----------------------------------------------------------------------
00528291   1/1  ----------------------------------------------------------------------
00461581   1/1  ----------------------------------------------------------------------
00520401   1/1  ----------------------------------------------------------------------
00493111   1/1  ----------------------------------------------------------------------
00519151   1/1  ----------------------------------------------------------------------
00490321   1/1  ----------------------------------------------------------------------
00496411   1/1  ----------------------------------------------------------------------
00527041   1/1  ----------------------------------------------------------------------
00518301   1/1  ----------------------------------------------------------------------
00528581   1/1  ----------------------------------------------------------------------
00514201   1/1  ----------------------------------------------------------------------
00498041   1/1  ----------------------------------------------------------------------
00486741   1/1  ----------------------------------------------------------------------
00523471   1/1  ----------------------------------------------------------------------
00514931   1/1  ----------------------------------------------------------------------
00513751   1/1  ----------------------------------------------------------------------
00513031   1/1  ----------------------------------------------------------------------
00461771   1/1  ----------------------------------------------------------------------
00532921   1/1  ----------------------------------------------------------------------
00498841   1/1  ----------------------------------------------------------------------
00469881   1/1  ----------------------------------------------------------------------
00517511   1/1  ----------------------------------------------------------------------
00512321   1/1  ----------------------------------------------------------------------
00458961   1/1  ----------------------------------------------------------------------
00514211   1/1  ----------------------------------------------------------------------
00526641   1/1  ----------------------------------------------------------------------
00431281   1/1  ----------------------------------------------------------------------
00514921   1/1  ----------------------------------------------------------------------
00501851   1/1  ----------------------------------------------------------------------
00481741   1/1  ----------------------------------------------------------------------
00513771   1/1  ----------------------------------------------------------------------
00507331   1/1  ----------------------------------------------------------------------
00530761   1/1  ----------------------------------------------------------------------
00528741   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RDLEMVREIFSNPSYMPDCVKIYPLYVVPNTELSEDWRRGLYKSYDEETWLELLAKIYASIPRWVRVMRF
00485961   1/1  agvnrlslgvQsfddevlkainRghtveevleavelareagfdsinldlIyGlPgetledfle-------
00431051   1/1  kirpghtyedvlealerareaGikvksglilgl.getdeellellellrelgk.rvdsvtiiellpvpgt
00512521   1/1  ----------------------------------------------------------------------
00502231   1/1  ----------------------------------------------------------------------
00509401   1/1  ----------------------------------------------------------------------
00488761   1/1  ----------------------------------------------------------------------
00472801   1/1  ----------------------------------------------------------------------
00514371   1/1  ----------------------------------------------------------------------
00480841   1/1  ----------------------------------------------------------------------
00512481   1/1  ----------------------------------------------------------------------
00528291   1/1  ----------------------------------------------------------------------
00461581   1/1  ----------------------------------------------------------------------
00520401   1/1  ----------------------------------------------------------------------
00493111   1/1  ----------------------------------------------------------------------
00519151   1/1  ----------------------------------------------------------------------
00490321   1/1  ----------------------------------------------------------------------
00496411   1/1  ----------------------------------------------------------------------
00527041   1/1  ----------------------------------------------------------------------
00518301   1/1  ----------------------------------------------------------------------
00528581   1/1  ----------------------------------------------------------------------
00514201   1/1  ----------------------------------------------------------------------
00498041   1/1  ----------------------------------------------------------------------
00486741   1/1  ----------------------------------------------------------------------
00523471   1/1  ----------------------------------------------------------------------
00514931   1/1  ----------------------------------------------------------------------
00513751   1/1  ----------------------------------------------------------------------
00513031   1/1  ----------------------------------------------------------------------
00461771   1/1  ----------------------------------------------------------------------
00532921   1/1  ----------------------------------------------------------------------
00498841   1/1  ----------------------------------------------------------------------
00469881   1/1  ----------------------------------------------------------------------
00517511   1/1  ----------------------------------------------------------------------
00512321   1/1  ----------------------------------------------------------------------
00458961   1/1  ----------------------------------------------------------------------
00514211   1/1  ----------------------------------------------------------------------
00526641   1/1  ----------------------------------------------------------------------
00431281   1/1  ----------------------------------------------------------------------
00514921   1/1  ----------------------------------------------------------------------
00501851   1/1  ----------------------------------------------------------------------
00481741   1/1  ----------------------------------------------------------------------
00513771   1/1  ----------------------------------------------------------------------
00507331   1/1  ----------------------------------------------------------------------
00530761   1/1  ----------------------------------------------------------------------
00528741   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GRDIPLHHVLDGPRWGNMRQIVLKHMERLGLKCQEIRCREVGIKLANNVPIQPGPVEVKKTEYEASGGLE
00485961   1/1  ----------------------------------------------------------------------
00431051   1/1  pladlp......plsleellrliavarlllpeaiir----------------------------------
00512521   1/1  ----------------------------------------------------------------------
00502231   1/1  ----------------------------------------------------------------------
00509401   1/1  ----------------------------------------------------------------------
00488761   1/1  ----------------------------------------------------------------------
00472801   1/1  ----------------------------------------------------------------------
00514371   1/1  ----------------------------------------------------------------------
00480841   1/1  ----------------------------------------------------------------------
00512481   1/1  ----------------------------------------------------------------------
00528291   1/1  ----------------------------------------------------------------------
00461581   1/1  ----------------------------------------------------------------------
00520401   1/1  ----------------------------------------------------------------------
00493111   1/1  ----------------------------------------------------------------------
00519151   1/1  ----------------------------------------------------------------------
00490321   1/1  ----------------------------------------------------------------------
00496411   1/1  ----------------------------------------------------------------------
00527041   1/1  ----------------------------------------------------------------------
00518301   1/1  ----------------------------------------------------------------------
00528581   1/1  ----------------------------------------------------------------------
00514201   1/1  ----------------------------------------------------------------------
00498041   1/1  ----------------------------------------------------------------------
00486741   1/1  ----------------------------------------------------------------------
00523471   1/1  ----------------------------------------------------------------------
00514931   1/1  ----------------------------------------------------------------------
00513751   1/1  ----------------------------------------------------------------------
00513031   1/1  ----------------------------------------------------------------------
00461771   1/1  ----------------------------------------------------------------------
00532921   1/1  ----------------------------------------------------------------------
00498841   1/1  ----------------------------------------------------------------------
00469881   1/1  ----------------------------------------------------------------------
00517511   1/1  ----------------------------------------------------------------------
00512321   1/1  ----------------------------------------------------------------------
00458961   1/1  ----------------------------------------------------------------------
00514211   1/1  ----------------------------------------------------------------------
00526641   1/1  ----------------------------------------------------------------------
00431281   1/1  ----------------------------------------------------------------------
00514921   1/1  ----------------------------------------------------------------------
00501851   1/1  ----------------------------------------------------------------------
00481741   1/1  ----------------------------------------------------------------------
00513771   1/1  ----------------------------------------------------------------------
00507331   1/1  ----------------------------------------------------------------------
00530761   1/1  ----------------------------------------------------------------------
00528741   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           IFLEAVGPDDTLYAILRLRIPNRPHRPELYKAALVRELHVYGPAVPVGKQGIWWQHSGMGRELMRLAEEI
00485961   1/1  ----------------------------------------------------------------------
00431051   1/1  ----------------------------------------------------------------------
00512521   1/1  -----------------------------------------------------yrgkGiGsaLlealeel
00502231   1/1  -----------------------------------------------------yrgkGiGraLleallel
00509401   1/1  -----------------------------------------------------yrgkGiGraLleallel
00488761   1/1  -----------------------------------------------------yrgkGiGraLleallel
00472801   1/1  -----------------------------------------------------yrgkGiGraLleallel
00514371   1/1  -----------------------------------------------------yrgkGiGraLleallel
00480841   1/1  -----------------------------------------------------yRGqGlGsaLldaaeee
00512481   1/1  -----------------------------------------------------yrgkGiGkaLleallel
00528291   1/1  -----------------------------------------------------yrgqGiGraLleaaeee
00461581   1/1  -----------------------------------------------------yrgkGiGraLleallel
00520401   1/1  -----------------------------------------------------yrgkGiGraLleallel
00493111   1/1  -----------------------------------------------------yrgrGiGraLlaallew
00519151   1/1  -----------------------------------------------------yrgkGiGkaLlealeel
00490321   1/1  -----------------------------------------------------yrgkGiGraLleallee
00496411   1/1  -----------------------------------------------------yrgkGiGraLlealley
00527041   1/1  -----------------------------------------------------yrgrGiGraLlealeel
00518301   1/1  -----------------------------------------------------yrgqGiGkaLleaalel
00528581   1/1  -----------------------------------------------------yrGkGiGsaLleaaler
00514201   1/1  -----------------------------------------------------yrgkGiGraLlealley
00498041   1/1  -----------------------------------------------------yrGkGiGraLlealley
00486741   1/1  -----------------------------------------------------yrGkGiGraLlrallve
00523471   1/1  -----------------------------------------------------yrGkGiGtaLlealley
00514931   1/1  -----------------------------------------------------yrgkGiGraLleallel
00513751   1/1  -----------------------------------------------------yrgkGigtallealley
00513031   1/1  -----------------------------------------------------yrgkGiGraLlealley
00461771   1/1  -----------------------------------------------------yrgkGiGraLleallel
00532921   1/1  -----------------------------------------------------yrgkGiGraLlealley
00498841   1/1  -----------------------------------------------------yrgkGiGraLlealley
00469881   1/1  -----------------------------------------------------yrgkGiGraLlealley
00517511   1/1  -----------------------------------------------------yrgkGiGsaLleallel
00512321   1/1  -----------------------------------------------------yrgkGiGsaLlealley
00458961   1/1  -----------------------------------------------------yRGkGiGraLleallee
00514211   1/1  -----------------------------------------------------yrgkGiGtaLlealley
00526641   1/1  -----------------------------------------------------yrgkGiGraLlealley
00431281   1/1  -----------------------------------------------------yrgqGiGkkLlealley
00514921   1/1  -----------------------------------------------------yrgkGiGraLlealley
00501851   1/1  -----------------------------------------------------yrgkGigtallealley
00481741   1/1  -----------------------------------------------------yrgkGiGraLlealley
00513771   1/1  -----------------------------------------------------yrGkGiGtallealley
00507331   1/1  -----------------------------------------------------yrgkGiGraLlealley
00530761   1/1  -----------------------------------------------------arGrGiGraLlealeel
00528741   1/1  -----------------------------------------------------yrgkGiGtallealley


                         -         -         +         -         -         -         -:490
query           AGEFGALKIAVISGVGVREYYRKLGYERCGPYMCKPLGAPLGVADDGLVAG-------------------
00485961   1/1  ----------------------------------------------------------------------
00431051   1/1  ----------------------------------------------------------------------
00512521   1/1  akergcrrlllevlneaairfYeklGFeevgeiedyy---------------------------------
00502231   1/1  arelglrrlvlevlpdNaairlYeklGFevvgelrly---------------------------------
00509401   1/1  arerlglrrlvlevnpaairfYeklGFevvgevyle----------------------------------
00488761   1/1  arelglkrlvlevneaairfYeklGFevvgelplyydgida-----------------------------
00472801   1/1  arelglrrlvlevneaairfYeklGFeevgelrlyy.g--------------------------------
00514371   1/1  arerglrrlvlevlvlpdNeaairlyeklGFevvgel---------------------------------
00480841   1/1  are.garrlvLevnaaarrfYerlGFvpvgelvyyylg--------------------------------
00512481   1/1  arelglkrlvlevladntaaialYeklGFevvgeled---------------------------------
00528291   1/1  arerglkrlylevdnpaairlYeklGFevvgelplyg---------------------------------
00461581   1/1  arerlglrrlvlevneaairfYeklGFevvgelryyl---------------------------------
00520401   1/1  arelglkrlvlevnpaairfYeklGFevvgelply-----------------------------------
00493111   1/1  arerGarrlvlevlpdNtaairlYeklGFeevgrledyy-------------------------------
00519151   1/1  akergckrlylevledNepairfYeklGFevvgelkgy--------------------------------
00490321   1/1  arelglkrlvlevneaairfYeklGFeevgelp-------------------------------------
00496411   1/1  arelglrrlvlevdpdNeaairfYeklGFeevgelrly--------------------------------
00527041   1/1  arergarrltlevneaairfYeklGFvvvgelelyyg---------------------------------
00518301   1/1  akelgakriylevneaaiafYeklGFevvgelelyygg--------------------------------
00528581   1/1  akelGlkriylevdeNeaairfYeklGFeevgelelyy--------------------------------
00514201   1/1  arelglrrlvlevladNeaairfYeklGFevvg-------------------------------------
00498041   1/1  arerglrrlvlevladNeaairfYeklGFeevg-------------------------------------
00486741   1/1  yarelGlrrsllgslllgiylevdpdNeaairlY------------------------------------
00523471   1/1  arerglrrlvlevdpdNeaairlYeklGFeevgelrly--------------------------------
00514931   1/1  arelglkrlvlevdneairfYeklGFevvgelpl------------------------------------
00513751   1/1  arelglrrlvlevdpdNeaairlyeklGFelvgelrd---------------------------------
00513031   1/1  areelglrrlvlevdneairfYeklGFeevge--------------------------------------
00461771   1/1  arerglkrlvlevdneairfYeklGFevvgelpd------------------------------------
00532921   1/1  arelglkrivlevlpdNeaairlYeklGFeevgelrd---------------------------------
00498841   1/1  arelglkrivlevlpdNeaairlyeklGFeev--------------------------------------
00469881   1/1  arelglkrivlevladNe.airlYeklGFeevgelpd---------------------------------
00517511   1/1  arelglkrlylevladNeaairfYeklGFvevgelrd---------------------------------
00512321   1/1  akelglkriylevladnpaiklYeklGFvpvge-------------------------------------
00458961   1/1  arerglkriylevledNeaadeslirfYekl.F-------------------------------------
00514211   1/1  arelglrrlvlevdpdNeaairlyeklGFe----------------------------------------
00526641   1/1  arerglrrlvlevlpdNeaairlYeklGFevvgelrly--------------------------------
00431281   1/1  arelglkrill..npaaikfyeklGFevvgel--------------------------------------
00514921   1/1  arelglrrlvlevlpdNeaairlyeklGFe.asedglk--------------------------------
00501851   1/1  arelglrrlvlevdpdNeaairlyeklGFelvgelrdyy-------------------------------
00481741   1/1  arelglrrlvlevlpdNeaairlyeklGFevvg-------------------------------------
00513771   1/1  afrelglrrlvlevdadNeaairlyeklGFe---------------------------------------
00507331   1/1  arelg.rrlvlevladNeaairlYeklGFevvge------------------------------------
00530761   1/1  arerlgarrlrlevledNaaaialYeklGFepvgelpdy-------------------------------
00528741   1/1  arelglkrivlevdpdNeaairlyeklGFe----------------------------------------