[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL63374.1


[Show Plain Result]

## Summary of Sequence Search
   1::327
   2::172  7.2e-31 29.6% 0046490 00464901 1/1   inding domain                           
   2::172  5.2e-30 33.1% 0046342 00463421 1/1   inding domain                           
   2::171  9.5e-28 26.8% 0044931 00449311 1/1   inding domain                           
   2::172    4e-26 29.6% 0046672 00466721 1/1   inding domain                           
   1::169  1.8e-23 30.1% 0047282 00472821 1/1   inding domain                           
   2::189  1.6e-22 33.0% 0050017 00500171 1/1   inding domain                           
   2::170  7.5e-21 29.9% 0047231 00472311 1/1   inding domain                           
 303::327  7.1e-05 44.0% 0046489 00464891 1/1   inked oxidases, C-terminal domain       
 303::326  8.8e-05 50.0% 0046341 00463412 2/2   inked oxidases, C-terminal domain       
 303::325    0.005 39.1% 0050336 00503362 2/2   inked oxidases, C-terminal domain       
 145::248    0.081 29.3% 0050336 00503361 1/2   inked oxidases, C-terminal domain       
 143::223     0.49 25.3% 0046341 00463411 1/2   inked oxidases, C-terminal domain       
   1::327


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRPKSVEELVELMKEANRDRRRLLPICKGSKAHLGPPVEYDEELQLWDMPKVLEVDEEEMVVRTSACISA
00464901   1/1  -rPesveevaaivklarehgipvvprggGtsllvggsvplgrggvvidlsrllnkileidpeggtvtvea
00463421   1/1  -lPtsteevaaivklanehgvpvvprgggtsllggalplgvdggvvldlsrmnrilevdpedltvtVeaG
00449311   1/1  -lPrsveevaaavklarehalsglpvvvrggghsllggalpaggvvldlsrlnriellellevdpeggtv
00466721   1/1  -lPrsteevaavlkacvelglpvvprgggtgltggavplgsdydrgvvvlslerlnrileid.egltvvv
00472821   1/1  vlPrsteevaalvklaaehglpvvprGggtslsggavpdgslvlgglvlslsrlngilevdlsaedltvt
00500171   1/1  -lpesveevaallklanehglpvlplGggsnllggd.lfdgvvi.lsrlngileidepedltvtveAGvl
00472311   1/1  -lPesteevaailklanehglpvvvrGggtnllggdvgfdgvvidlsrlnki.eided..tvtvgaGvll
00464891   1/1  ----------------------------------------------------------------------
00463412   2/2  ----------------------------------------------------------------------
00503362   2/2  ----------------------------------------------------------------------
00503361   1/2  ----------------------------------------------------------------------
00463411   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VELQEELRKRGRRLALDPPLFRRSSIGGILSTNFYGPMAYRYMTPRDQLLSVKIVTGKGEFMKFGAPVVK
00464901   1/1  GvtlgdlyealaehglelalpldpgscitvtvGGaiagn..GigslryGlaadnvlglevvladGeivta
00463421   1/1  vtlgdlyealaehgltlpvdpg..gsatigGvialtnagGlgslryGltrdnvlglevvladGevvrlga
00449311   1/1  tveaGvtlgdlyealaehglalpvdg.slptvtvGGliaggghgtlslryGltadnvlglevvladGevv
00466721   1/1  epGvtladlnealaplgllfppdpgsagisatigGnvatnagGllvlrygatrdlvllalvdedgelelv
00472821   1/1  veAGvvladlaealakhglalpnlp.sigsatiGGaiatnaggtglllgGglgllslrygllsdlvlgle
00500171   1/1  ladlvealaehgl.fgleplsgipgtiGGaiatnagg.....yGveirdlvlslevvdladgeiltlsae
00472311   1/1  adlvealaehgl.lgleplsgipgtiGGaiatnagg.....yGletrdnvlslevvladGeivtls....
00464891   1/1  ----------------------------------------------------------------------
00463412   2/2  ----------------------------------------------------------------------
00503362   2/2  ----------------------------------------------------------------------
00503361   1/2  ----------------------------------------------------------------------
00463411   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DVAGYNIKRLIAGSWGTLAVLVEAYMRIYALPESVAVMATGRKSLQELRKLHVAGAAEADGVLYLRFEGV
00464901   1/1  sgrllknlyrkslllkntlllllsagpdlfwa--------------------------------------
00463421   1/1  ellknsagydlfwalrgglldglfsegtlGiv--------------------------------------
00449311   1/1  t.....asasegydlfwalrgsegtlGvvte---------------------------------------
00466721   1/1  nhlglevvladgevldtlsglrkdllaldlee--------------------------------------
00472821   1/1  vvladGevltls....kdelgydlfqall-----------------------------------------
00500171   1/1  ..klnfgyrls.lfkgsegtlgiiteatlkllplpkavilal.llelld---------------------
00472311   1/1  kddlgfdlrglflgseg..giiteatlkll----------------------------------------
00464891   1/1  ----------------------------------------------------------------------
00463412   2/2  ----------------------------------------------------------------------
00503362   2/2  ----------------------------------------------------------------------
00503361   1/2  ----pdlvrllrgsYgdlgiftedqlrLiplpegaallllgrfdyvegavelvddvllnlarsipagled
00463411   1/2  --patrllllffgsegtlgeavllliplgipllipglvvllnvlleaallvlrrgelpaalelm..ddva


                         -         -         -         +         -         -         -:280
query           KSEVEYRLSKAGRGDVFYDREAEEKWSSVTEAEELFASNEIAKVVAPPASLPETPPGVKYLRYPLLGVMY
00464901   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00449311   1/1  ----------------------------------------------------------------------
00466721   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------
00472311   1/1  ----------------------------------------------------------------------
00464891   1/1  ----------------------------------------------------------------------
00463412   2/2  ----------------------------------------------------------------------
00503362   2/2  ----------------------------------------------------------------------
00503361   1/2  mdrvailavepfagvlycle.....lvkeydgsdeeva--------------------------------
00463411   1/2  leavlallglglp---------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VAGPPPAGVKAYWLKPQRKWDVENRDLMEKIKRVLDPNGVLSPGRLP-----------------------
00464901   1/1  ----------------------------------------------------------------------
00463421   1/1  ----------------------------------------------------------------------
00449311   1/1  ----------------------------------------------------------------------
00466721   1/1  ----------------------------------------------------------------------
00472821   1/1  ----------------------------------------------------------------------
00500171   1/1  ----------------------------------------------------------------------
00472311   1/1  ----------------------------------------------------------------------
00464891   1/1  ----------------------allalmraiKkafDPkgiLNPGkll-----------------------
00463412   2/2  ----------------------allalmraiKaafDPngiLNPGkl------------------------
00503362   2/2  ----------------------alwelfvelKaafDPngiLnPGk-------------------------
00503361   1/2  ----------------------------------------------------------------------
00463411   1/2  ----------------------------------------------------------------------