[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL63439.1


[Show Plain Result]

## Summary of Sequence Search
   1::69
   1::69     3e-08 27.5% 0043518 00435181 1/1   drug resistance efflux transporter EmrE 
   1::69


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGVFGTVIPYRLFSSAVTKIEGARASVIASVEPVLAALWGFLFFKEIPGLLTLTAYALISTAAVVVARK-
00435181   1/1  lgllltalaflllflalkrlpaglayalllylgpvfaallgwlllgErlsllqllGialilaGvlllll-