[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL63787.1


[Show Plain Result]

## Summary of Sequence Search
   1::142
  64::119  1.8e-14 42.9% 0053232 00532322 2/2   omain                                   
  67::120  3.5e-13 40.7% 0042237 00422372 2/2   omain                                   
  70::120  4.2e-13 41.2% 0045120 00451202 2/2   omain                                   
  64::120  4.5e-13 35.1% 0042493 00424932 2/2   omain                                   
  70::120  4.8e-13 45.1% 0048350 00483502 2/2   omain                                   
  62::119  5.4e-13 37.9% 0042238 00422382 2/2   omain                                   
  67::119  7.8e-13 43.4% 0051201 00512012 2/2   omain                                   
  66::120    8e-13 40.0% 0051202 00512022 2/2   omain                                   
  66::143    8e-13 32.9% 0053224 00532242 2/2   omain                                   
  68::122  8.8e-13 41.8% 0052380 00523802 2/2   omain                                   
  65::120  1.2e-12 39.3% 0053231 00532312 2/2   omain                                   
  63::120  1.9e-12 32.8% 0048351 00483512 2/2   omain                                   
  71::120  5.6e-12 42.0% 0045121 00451212 2/2   omain                                   
  67::120  5.9e-12 38.9% 0050302 00503022 2/2   omain                                   
  62::120  7.3e-12 35.6% 0042494 00424942 2/2   omain                                   
  70::118  7.8e-12 42.9% 0039484 00394842 2/2   omain                                   
  67::119  1.1e-11 41.5% 0052381 00523812 2/2   omain                                   
  65::119  1.3e-11 40.0% 0051257 00512572 2/2   omain                                   
  66::120  2.7e-11 36.4% 0050301 00503012 2/2   omain                                   
  66::119  2.8e-11 38.9% 0041683 00416832 2/2   omain                                   
  72::119  2.4e-10 41.7% 0039485 00394852 2/2   omain                                   
   5::67   5.9e-10 23.8% 0045120 00451201 1/2   omain                                   
   1::64   6.6e-10 28.6% 0051202 00512021 1/2   omain                                   
  66::119  9.3e-10 40.4% 0051258 00512582 2/2   omain                                   
   6::68   1.6e-09 25.8% 0045121 00451211 1/2   omain                                   
   1::63   2.4e-09 31.1% 0053232 00532321 1/2   omain                                   
   2::61   4.7e-09 29.3% 0042237 00422371 1/2   omain                                   
   1::61   4.8e-09 28.3% 0053224 00532241 1/2   omain                                   
   2::59   7.3e-09 32.1% 0051201 00512011 1/2   omain                                   
   5::57   7.3e-09 32.1% 0048350 00483501 1/2   omain                                   
   1::63   1.1e-08 30.6% 0042493 00424931 1/2   omain                                   
   1::60   1.4e-08 29.3% 0052380 00523801 1/2   omain                                   
   2::63   1.4e-08 26.2% 0050302 00503021 1/2   omain                                   
   1::58   1.5e-08 30.4% 0042238 00422381 1/2   omain                                   
   1::61   3.4e-08 26.7% 0050301 00503011 1/2   omain                                   
   1::64   3.8e-08 27.0% 0041683 00416831 1/2   omain                                   
   1::61     5e-08 28.3% 0042494 00424941 1/2   omain                                   
   1::63   6.2e-08 29.0% 0053231 00532311 1/2   omain                                   
   7::58   8.3e-08 25.5% 0039485 00394851 1/2   omain                                   
   1::58   8.8e-08 24.6% 0048351 00483511 1/2   omain                                   
   1::66   1.6e-07 22.7% 0052381 00523811 1/2   omain                                   
   1::62   1.8e-07 32.2% 0051258 00512581 1/2   omain                                   
   5::55   2.7e-07 29.4% 0039484 00394841 1/2   omain                                   
   1::61   2.8e-07 30.0% 0051257 00512571 1/2   omain                                   
   1::142


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNAGAIASKNVICIKPGASILDAAKLMAQRNIGFLIVSSDCKRDLAGVISERDIIRAIASGIQPSEPVDN
00532322   2/2  ---------------------------------------------------------------ldltvsd
00422372   2/2  ------------------------------------------------------------------kvrd
00451202   2/2  ---------------------------------------------------------------------d
00424932   2/2  ---------------------------------------------------------------ldltvsd
00483502   2/2  ---------------------------------------------------------------------d
00422382   2/2  -------------------------------------------------------------dlldltvsd
00512012   2/2  ------------------------------------------------------------------kvsd
00512022   2/2  -----------------------------------------------------------------ltvsd
00532242   2/2  -----------------------------------------------------------------gllls
00523802   2/2  -------------------------------------------------------------------vgd
00532312   2/2  ----------------------------------------------------------------dltvsd
00483512   2/2  --------------------------------------------------------------lddltvsd
00451212   2/2  ----------------------------------------------------------------------
00503022   2/2  ------------------------------------------------------------------kvsd
00424942   2/2  -------------------------------------------------------------dlddltvgd
00394842   2/2  ---------------------------------------------------------------------d
00523812   2/2  ------------------------------------------------------------------tvsd
00512572   2/2  ----------------------------------------------------------------dltvgd
00503012   2/2  -----------------------------------------------------------------lkvsd
00416832   2/2  -----------------------------------------------------------------ltvsd
00394852   2/2  ----------------------------------------------------------------------
00451201   1/2  ----dimtrdvvtvspdttleealelmlehgisrlpVvdegddgklvGivtlrDllralleelalkd---
00512021   1/2  ltvsdimtrdvvtvspdtsleealelmlehgigalpVvded.grlvGiitlrDllralleelld------
00512582   2/2  -----------------------------------------------------------------eglel
00451211   1/2  -----imtrdvvtvspdtsleealelmlehgisrlpVvded.gklvGivtlrDllkalvgeialedll--
00532321   1/2  ldltvsdimtrdvvtvspdtsleeaaelmlehgigalpVvd..dgrlvGiitlrdllrallee-------
00422371   1/2  -kvrdimtrdvvtvspdtsleealelmlesgisrlpVvdd..gklvGivtlrdllralvge---------
00532241   1/2  glllslldltvkdimtrdvvtvspdtsleealelmlenrisalpVvded.grlvGiitlrD---------
00512011   1/2  -kvsdimtrdvvtvspdtsleealelmlehgisrlpVvdd..gklvGiitlrdllrall-----------
00483501   1/2  ----dimtrdvvtvspdttleeaaelmlehgigalpVvddgeldgklvGivtlrDll-------------
00424931   1/2  ldltvsdimtkdvvtvspdtsleealklmlengisrlpVvded.gklvGivtlrdllrallge-------
00523801   1/2  llvgdimdpspitvspdtslleaarlfrklgirrlpVvdn..gklvGivtlkdllkaieg----------
00503021   1/2  -kvsdimtrdvvtvspdtsleealelmlehgisrlpVvded.grlvGivtlrdllrallgeld-------
00422381   1/2  dlldltvsdimtrdvvtvspdtsleealelmlehgisrlpVvdd..gklvGivtlrdl------------
00503011   1/2  lkvsdimtrdvvtvspdatllealelmlekgisalpVvded.gklvGivtlrdllealvge---------
00416831   1/2  ltvsdimtrdvvtvspdtsleealelmlehgisrlpVvded.gklvGivtlrdllrallgeild------
00424941   1/2  dlddltvgdimtpdvvtvspdtsleealelmrekgisrlpVvded.gklvGivtlrDllra---------
00532311   1/2  dltvsdimtrdvvtvspdtsleealelmlehgigalpVvded.gklvGiitlrdllralleel-------
00394851   1/2  ------mtrdvvtvspdttleealelmlehgisrlpVvded.gklvGivtlrdllkal------------
00483511   1/2  lddltvsdimtpredvvtvspdttleealelmlesgisrlpVvded.gklvGivtlkd------------
00523811   1/2  lllnvllllnltvsdimtrdvvtvspdttleealellletgirrlpVvdseedgrlvGiitrrdll----
00512581   1/2  egleleklldltvkdimttdvvtvspddsleealelml..kigflpVvded.gklvGiitrr--------
00394841   1/2  ----dimtrdvvtvspdtsleealelmlehgigrlpVvdegeldgklvGivtlrD---------------
00512571   1/2  dltvgdimtprrdvvtvspdtsleealelmletgisrlpVvded.grlvGiitlrdllral---------


                         -         -         *         -         -         -         -:140
query           IMTRKVVYVYKDTPVWEIARLMRKYNIRHILVMDNGQIFGVISIRDLLKESDVIERLVEYAEERIDEISA
00532322   2/2  imtrdvvtvspdtsleeaaelmlehgigalpVvddgrlvGiitlrdllr---------------------
00422372   2/2  imtrdvvtvspdtsleealelmlesgisrlpVvddgklvGivtlrdllra--------------------
00451202   2/2  imtrdvvtvspdttleealelmlehgisrlpVvdegddgklvGivtlrDl--------------------
00424932   2/2  imtkdvvtvspdtsleealklmlengisrlpVvdedgklvGivtlrdllr--------------------
00483502   2/2  imtrdvvtvspdttleeaaelmlehgigalpVvddgeldgklvGivtlrD--------------------
00422382   2/2  imtrdvvtvspdtsleealelmlehgisrlpVvddgklvGivtlrdllr---------------------
00512012   2/2  imtrdvvtvspdtsleealelmlehgisrlpVvddgklvGiitlrdllr---------------------
00512022   2/2  imtrdvvtvspdtsleealelmlehgigalpVvdedgrlvGiitlrDllr--------------------
00532242   2/2  lldltvkdimtrdvvtvspdtsleealelmlenrisalpVvdedgrlvGiitlrDllra..lleelldll
00523802   2/2  imdpspitvspdtslleaarlfrklgirrlpVvdngklvGivtlkdllkaie------------------
00532312   2/2  imtrdvvtvspdtsleealelmlehgigalpVvdedgklvGiitlrdllr--------------------
00483512   2/2  imtpredvvtvspdttleealelmlesgisrlpVvdedgklvGivtlkdl--------------------
00451212   2/2  imtrdvvtvspdtsleealelmlehgisrlpVvdedgklvGivtlrDllk--------------------
00503022   2/2  imtrdvvtvspdtsleealelmlehgisrlpVvdedgrlvGivtlrdllr--------------------
00424942   2/2  imtpdvvtvspdtsleealelmrekgisrlpVvdedgklvGivtlrDllr--------------------
00394842   2/2  imtrdvvtvspdtsleealelmlehgigrlpVvdegeldgklvGivtl----------------------
00523812   2/2  imtrdvvtvspdttleealellletgirrlpVvdseedgrlvGiitrrd---------------------
00512572   2/2  imtprrdvvtvspdtsleealelmletgisrlpVvdedgrlvGiitlrd---------------------
00503012   2/2  imtrdvvtvspdatllealelmlekgisalpVvdedgklvGivtlrdlle--------------------
00416832   2/2  imtrdvvtvspdtsleealelmlehgisrlpVvdedgklvGivtlrdll---------------------
00394852   2/2  -mtrdvvtvspdttleealelmlehgisrlpVvdedgklvGivtlrdll---------------------
00451201   1/2  ----------------------------------------------------------------------
00512021   1/2  ----------------------------------------------------------------------
00512582   2/2  eklldltvkdimttdvvtvspddsleealelml..kigflpVvdedgkl---------------------
00451211   1/2  ----------------------------------------------------------------------
00532321   1/2  ----------------------------------------------------------------------
00422371   1/2  ----------------------------------------------------------------------
00532241   1/2  ----------------------------------------------------------------------
00512011   1/2  ----------------------------------------------------------------------
00483501   1/2  ----------------------------------------------------------------------
00424931   1/2  ----------------------------------------------------------------------
00523801   1/2  ----------------------------------------------------------------------
00503021   1/2  ----------------------------------------------------------------------
00422381   1/2  ----------------------------------------------------------------------
00503011   1/2  ----------------------------------------------------------------------
00416831   1/2  ----------------------------------------------------------------------
00424941   1/2  ----------------------------------------------------------------------
00532311   1/2  ----------------------------------------------------------------------
00394851   1/2  ----------------------------------------------------------------------
00483511   1/2  ----------------------------------------------------------------------
00523811   1/2  ----------------------------------------------------------------------
00512581   1/2  ----------------------------------------------------------------------
00394841   1/2  ----------------------------------------------------------------------
00512571   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           HD--------------------------------------------------------------------
00532322   2/2  ----------------------------------------------------------------------
00422372   2/2  ----------------------------------------------------------------------
00451202   2/2  ----------------------------------------------------------------------
00424932   2/2  ----------------------------------------------------------------------
00483502   2/2  ----------------------------------------------------------------------
00422382   2/2  ----------------------------------------------------------------------
00512012   2/2  ----------------------------------------------------------------------
00512022   2/2  ----------------------------------------------------------------------
00532242   2/2  dll-------------------------------------------------------------------
00523802   2/2  ----------------------------------------------------------------------
00532312   2/2  ----------------------------------------------------------------------
00483512   2/2  ----------------------------------------------------------------------
00451212   2/2  ----------------------------------------------------------------------
00503022   2/2  ----------------------------------------------------------------------
00424942   2/2  ----------------------------------------------------------------------
00394842   2/2  ----------------------------------------------------------------------
00523812   2/2  ----------------------------------------------------------------------
00512572   2/2  ----------------------------------------------------------------------
00503012   2/2  ----------------------------------------------------------------------
00416832   2/2  ----------------------------------------------------------------------
00394852   2/2  ----------------------------------------------------------------------
00451201   1/2  ----------------------------------------------------------------------
00512021   1/2  ----------------------------------------------------------------------
00512582   2/2  ----------------------------------------------------------------------
00451211   1/2  ----------------------------------------------------------------------
00532321   1/2  ----------------------------------------------------------------------
00422371   1/2  ----------------------------------------------------------------------
00532241   1/2  ----------------------------------------------------------------------
00512011   1/2  ----------------------------------------------------------------------
00483501   1/2  ----------------------------------------------------------------------
00424931   1/2  ----------------------------------------------------------------------
00523801   1/2  ----------------------------------------------------------------------
00503021   1/2  ----------------------------------------------------------------------
00422381   1/2  ----------------------------------------------------------------------
00503011   1/2  ----------------------------------------------------------------------
00416831   1/2  ----------------------------------------------------------------------
00424941   1/2  ----------------------------------------------------------------------
00532311   1/2  ----------------------------------------------------------------------
00394851   1/2  ----------------------------------------------------------------------
00483511   1/2  ----------------------------------------------------------------------
00523811   1/2  ----------------------------------------------------------------------
00512581   1/2  ----------------------------------------------------------------------
00394841   1/2  ----------------------------------------------------------------------
00512571   1/2  ----------------------------------------------------------------------