[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL64120.1


[Show Plain Result]

## Summary of Sequence Search
   1::274
  63::268  1.5e-45 37.0% 0035601 00356011 1/1   ependent nitroreductase-like            
  62::254  2.3e-40 38.8% 0037401 00374011 1/1   ependent nitroreductase-like            
  62::254  1.3e-35 37.9% 0051556 00515561 1/1   ependent nitroreductase-like            
  63::269  4.8e-34 39.2% 0051924 00519241 1/1   ependent nitroreductase-like            
  63::275  4.3e-30 35.8% 0052748 00527481 1/1   ependent nitroreductase-like            
  63::269    1e-26 32.8% 0051432 00514321 1/1   ependent nitroreductase-like            
  62::269  6.5e-23 32.9% 0044736 00447361 1/1   ependent nitroreductase-like            
  65::254    9e-22 37.5% 0044848 00448481 1/1   ependent nitroreductase-like            
  63::268  1.8e-21 30.6% 0041494 00414941 1/1   ependent nitroreductase-like            
  63::269  4.3e-20 27.9% 0036576 00365761 1/1   ependent nitroreductase-like            
  64::266    3e-17 29.0% 0041335 00413351 1/1   ependent nitroreductase-like            
  63::254  5.9e-11 25.4% 0053102 00531021 1/1   ependent nitroreductase-like            
   1::274


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIRRGFLKFLFITPLGRLISGVLSAGIFSGVIFLDVIRTDVRKRTGADVEKVLLPYPRLRGVVSVEEALA
00356011   1/1  --------------------------------------------------------------mdllelil
00374011   1/1  -------------------------------------------------------------mmellelil
00515561   1/1  -------------------------------------------------------------mmdllelik
00519241   1/1  --------------------------------------------------------------mdllellk
00527481   1/1  --------------------------------------------------------------llllllll
00514321   1/1  --------------------------------------------------------------lllmmdll
00447361   1/1  -------------------------------------------------------------mmdllelik
00448481   1/1  ----------------------------------------------------------------dvleai
00414941   1/1  --------------------------------------------------------------pmmdvlea
00365761   1/1  --------------------------------------------------------------mdvlelil
00413351   1/1  ---------------------------------------------------------------dvleail
00531021   1/1  --------------------------------------------------------------mdflellk


                         -         -         *         -         -         -         -:140
query           NRRSVREFREEPLTLEELGQILWAAYGISETRYGLRTAPSAGAQYPLEVYVVVGEHGVKTGDGYLKPGVY
00356011   1/1  sRrSvRkFtdepvpdevleelleaa..........rlAPssgnlqpwrfvvv..................
00374011   1/1  sRrSvRkFtdepvpeevleelleaA..........rlAPSsgnlqpwrfivv..................
00515561   1/1  sRrSvRkFddepvsdevleeileaa..........rlAPSsgnlQpwrfvvv..................
00519241   1/1  sRrSvrkfddepvsdevleeileaa..........rlAPSsgnlqpwrfvv...................
00527481   1/1  lmmdllelllsRrSvrafddepvpeevleeileaA..........rlAPSsgnlqpwrfvvvtr......
00514321   1/1  eliksRrSvRkfkdelpvsdevleeileaa..........rlAPSsgnlqpwrfvvvtdeelkkllaela
00447361   1/1  sRrsvRafdtdkpvpdevleelleaa..........rlAPSsgnlqpwrfvvvedpelkeklaellaeal
00448481   1/1  ksRrSvRkFldkpvpkelleeilea....................qPWrfvvvtgeelkeklaall....
00414941   1/1  ilsRrsvRkFdpkpipdedleeileaa..........rlAPSslnlQpwrfvvvedeelkeklaela.fn
00365761   1/1  sRrsvRafdpdkpisdedleeileaa..........rlAPSsvnlqpwrfvvvrseelkeklaelaagal
00413351   1/1  sRrsvRafdpdkpvsdedleeileaa..........rlAPSsvnlQpwrfvvvrdeelkeklaeaaagal
00531021   1/1  kRrSvrafdpdlkisdeelielilea.........aklAPSafNsQpwrfvvvlgeehkklwdiva...e


                         +         -         -         -         -         *         -:210
query           HYDPHSHTLTLKKTGDFREALYQAALEQIWVLKAPVSLIFTAVYSRTVRVYGERGRVRYVPMDLGHAGQN
00356011   1/1  .............tdpelreklaellgnqeyvadapvlivvvadlerlaklpellqlgelelllvallda
00374011   1/1  ............tdpelreklaelalgqeyladapvllvvvadldrlakllellg.lgeltlllyalvda
00515561   1/1  ............tdpelkeklaelagnqpyvadapvlivvvadldrvekllelfglaaaallgelelllw
00519241   1/1  ............vtdpelreklaealgnqekvldapvlivvladldrarklplleqlygalgifeedlea
00527481   1/1  .......................dgelkeklaellaegnqeklldapvlivvladldlseklpelll.ll
00514321   1/1  ..............eallalvpeeaflatelnqegfldApvlivvfadldlveklpelfplgaellplwa
00447361   1/1  .........................egnqeqlldapvlivvladtdrleelvellldrrvevglllyeal
00448481   1/1  ..........................lgnkqlfgApalivvvadkd............eyalldtgialq
00414941   1/1  qpqvldasaliv..fladldralaildlvllllladelllalllallglflalgeetlldwalldaylaa
00365761   1/1  afnqpqvldasalvvvladtdltelllelyldallelgrlldeeraalllllrgffaallllsladlrdw
00413351   1/1  afnqpqvldasvlivvladtdlteellelvldllvelgrtldeeleaavllllaafaellllllrdlrdw
00531021   1/1  nlkkvvpasavfavtgdl.lalfkagygtilffedgavvealqelfp..lyadnfpvwseassgmalaam


                         -         -         -         +         -         -         -:280
query           VYLQATALGLGTVAVGAFYDDQVAEILDLPDGETPLYIMPIGRPIYQYRLTEAELIRYIEKSRR------
00356011   1/1  giaaqnlllaAralGLgtcwiggflnddeavrelLglpedevpvaglalGypaeeppp------------
00374011   1/1  giaaqnlllaAealGLgtcwiggfrndpeavrelLglpedvvpv--------------------------
00515561   1/1  alvdagiaaqnlllaAaalGLgtcpiggfrndpeavrelLglpe--------------------------
00519241   1/1  lleqllrnfllfgaellllwalldagiaaqnlllaAaalGlgtcpiggfdpeavrellg-----------
00527481   1/1  ealldagiaaqnlllaAralGlgtcwiggfdpeavrellglpegerpvallalGypdeeaplpel-----
00514321   1/1  lldagiaaqnlllaAralGlgtcwigylgfddeavrellglpedlklvallalGypdee-----------
00447361   1/1  gnlllflapvlllllgdkvladwalldaglaaqnlllaAralGlgtcpiggfdpeavre-----------
00448481   1/1  nlmLaAtalGLgtcwiggfddkdlvlilviglprlaeaektrrp--------------------------
00414941   1/1  qnlllaAralGlgtcpiggfdpekvrelLglpegyvpvvllalGypaeeplpkpRlpl------------
00365761   1/1  alrdaglaagnlmlaAralGldtcpmggfdpekvrelLglpedgyvpvvlvalGyrdee-----------
00413351   1/1  aardaglaaqnlmlaAralGldtcpmggfdaekvrelLglpedgyvpvvlvalGyr--------------
00531021   1/1  wlalaaeglGaslqhynpliddavaellniPedwklvallpfGy--------------------------