[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for paer1:AAL64265.1


[Show Plain Result]

## Summary of Sequence Search
   1::360
   1::285    8e-47 33.0% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
 284::356    5e-21 46.6% 0052725 00527251 1/1   ed helix" DNA-binding domain            
   1::273  7.6e-14 23.3% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
   1::271    6e-13 24.9% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
   1::274  4.1e-12 22.8% 0047665 00476651 1/1   p containing nucleoside triphosphate hy 
   1::260  4.2e-12 27.3% 0049491 00494911 1/1   p containing nucleoside triphosphate hy 
   7::242  4.6e-09 25.5% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
   2::220    6e-09 26.9% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
   2::248  7.1e-09 24.3% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
   7::247  6.7e-08 24.5% 0049053 00490531 1/1   p containing nucleoside triphosphate hy 
   1::280  1.4e-07 23.7% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
   3::257  4.4e-07 24.5% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
   9::244  6.1e-07 26.3% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
   6::244  6.4e-07 26.4% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
   5::278  1.6e-06 20.3% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
   1::257  4.4e-06 22.7% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
   1::244  3.3e-05 26.6% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
   1::244  4.2e-05 25.7% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
   2::244  6.1e-05 21.2% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
   4::280   0.0001 20.3% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
   1::240  0.00092 23.2% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
   1::278  0.00094 24.5% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
   1::360


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLFRDRPAERLEELFDREEEVRRLLNAVNSSALTLILGMRRVGKTSVVKAATYGKLRIYIDARYFEEKRY
00527261   1/1  npfilgpkvdledfigreeelkeleeal.pk.ivlltGprGsGKTtllkalakelgkpviyidlselssk
00527251   1/1  ----------------------------------------------------------------------
00474201   1/1  deelelleklslllveklrpvllddlvgqeeakeallealragrpghvllvGppGtGKTtlaralanelp
00437921   1/1  lglllveklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvi
00476651   1/1  yeplveklrpvllddlvgqeeakeallealaggrpprpvllvGppGtGKTtlaral.anelgrpfvpval
00494911   1/1  llveklrpvllddlvgqeeakeallealaagrpghvllvGppGtGKTtlaralanellrlgvlglpfvrv
00503741   1/1  ------fifldlrplallplpdrlvgrdeeiealskalggaldgvslsiepggivllvGppGvGKTtLak
00394721   1/1  -lleklrpvllddvvgreealeallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvp
00402371   1/1  -vlektgipltkllrpvllddviGqeealeallealrrrpgrnvllvGppGvGKTtlaralagllvrssg
00490531   1/1  ------tlpaleseardltekarpvllddviGqeeaierllealergppgnvLlvGppGtGKTtlarala
00437901   1/1  slllvekyrpvllddvvgqeeakeallealalararplkrpelflslgirpgrillLyGppGvGKTtlak
00404191   1/1  --vellpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvl
00367291   1/1  --------vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel
00420941   1/1  -----lrpvllddvigqeeakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakalagel
00386741   1/1  ----klrpvllddvvgqeeakeallealkavllgirpgehllLvGppGtGKTtlaralagelgapfvrld
00437941   1/1  plveklrpknlddvygqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvlgid
00406781   1/1  plveklrpvllddvigqeeakeallealaglrlllkdlslgippgknvllvGppGtGKTtlakalagelg
00521551   1/1  plveklrpvllddvigqeeakeallealarlkapelflslglrpgkgvlLvGppGtGKTtlaralagllg
00437981   1/1  -lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldgk
00473941   1/1  ---eklrpvllddvvgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagllgapfiels
00418301   1/1  drplleklrpvllddviGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlarala
00379261   1/1  drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaralA


                         -         -         *         -         -         -         -:140
query           ISYGDLLEALRKELRRLLPLHKRLGELLSKIRGVSVAGVDVKFEIGRNAPSFAEILEAFDQWAREQGERL
00527261   1/1  gyvdleellrelaeelgellellkkllkklsellglsilg..lelilglsggdleelleelaellkklgk
00527251   1/1  ----------------------------------------------------------------------
00474201   1/1  rslpglpfvrvnasdltd.....vglleellgkllgaat...............................
00437921   1/1  elda.....sdlrgvddlreligevlqalglllgg...................................
00476651   1/1  lcfvrvncaallelsasdll............................eselfgeekeaflgallerlgk
00494911   1/1  nasellealllsdlfgellgallralfellrgalela.................................
00503741   1/1  llagllkpkfgeillfgkvvyvnvselldl...........kellrllleal.glpppyq.........l
00394721   1/1  vvrldlsellsvsdlvgel..........................................egglrgllt
00402371   1/1  pilldgvpfvrldaselle...............................................fgky
00490531   1/1  kelargdvpevlvgvpvieinassllfGskyvgefeealr..............................
00437901   1/1  alakel.....gapv....ieidaselrdvddlsgyvgelsggeklrellaealteav............
00404191   1/1  yvsa................................delvsklsggl...............qeqrvaia
00367291   1/1  gapfirvda................................selleklvg................egeg
00420941   1/1  gapfiridg................................sellgkyvgelsggl..............
00386741   1/1  a....................................selsg..................geklrgllar
00437941   1/1  aselldpselsggerqrvliarall.............................................
00406781   1/1  vpfvrisa................................sellgkyvgelsgglrqrlalaraa.....
00521551   1/1  apfvrlsas................................elvgkyvgelegglrqllalaraa.....
00437981   1/1  dirrgiglvfqliglfphltvlelvalgl.....ggilveevrellkel.....................
00473941   1/1  asdllg......esdlrggfkqa...............................................
00418301   1/1  kllgrpfirvdaselteaelvGy.....esgarlrelf................................
00379261   1/1  kllgapfvevdaselteggyvgedlekrirelfqearllvfltvlenirldaseylekrvvsrligappg


                         +         -         -         -         -         *         -:210
query           VLIIDEAQELAKLRGRTLLPPLGYAYDNLRNISMVFTGSKAGLLLRFLRLEDPHSPLFGRYFEKIELGPF
00527261   1/1  pvililDEiqslldvsskelleaLlrlldegknvtiiltgsdlglldelllrpdlksplygRfdeiielk
00527251   1/1  ----------------------------------------------------------------------
00474201   1/1  ..............fllakpgvlflDEidkldpdvqnaLlrlle...elpsnvrviattnrpl.......
00437921   1/1  .........kpdvlllDEidrldpdaqnallklleel...pagvtlilttnrle..........ellpal
00476651   1/1  lalagggtvlflDEidkldpdvqnaLlrllee...ppsnvrvilttn.........rpekldpallsRf.
00494911   1/1  .............kggvlflDEidrlspdvqnaLlrllee...lpsnvrviattnrpel.........ld
00503741   1/1  sggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelLlrlleegkltdkllgltliltthdl
00394721   1/1  ealalakpsvlflDEidrlldardsesslevlnaLlrlledg.....nvlviattnrpellgrl.....e
00402371   1/1  vgafegglrqllglaraa.kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg.....nvrviaatn
00490531   1/1  ............rlfgeaekanggviLflDEidklagargsggspdvqnaLlrlle.....rgnvrvIaa
00437901   1/1  ....................lkgkpsvlllDEidaldpdvlnallklldglr.dlsgvliilttn.....
00404191   1/1  falark....pdllllDEidalgldpelqeellelldelaer..gvtlilttnnrpeeldqallr.....
00367291   1/1  rlrgalaealradp..gvlflDEidalagkrgsgtsrldpevqnaLlrlleelrv.lsgvlviattnr..
00420941   1/1  ..rqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlldglq.alsnvtviattn
00386741   1/1  ala...kpgvlllDEidaldpdvqeallelleegeltivgggllteldgl.llpsgvlviattnrpel..
00437941   1/1  .....adpkvlllDEidaldpeaqnaLlklleel...pkgvtvilttn.........rleeldpallsRf
00406781   1/1  .............dpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviattnd.
00521551   1/1  .............npgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegle.dlsnvlviaatn.
00437981   1/1  .........................lsgGqkqrvaiaralagdpkvlllDEptaldpdaqnaLlklleel
00473941   1/1  .....akpgvlflDEidrldrevqnaLlelle...elqvtilggglvvvelllllpsgvlviaatnrpel
00418301   1/1  ...........aragigllaladpgvlflDEidkllpargssggdvsredvlnaLlrlleegeltilggg
00379261   1/1  yvgyglggllteavrrlpysvl....lldelekahrpirvlllsaslvlllgglglpevgelllellddv


                         -         -         -         +         -         -         -:280
query           SRELSVQFLTKGFEEAGVRVSRELIDRAVDELDGVVGWLAYFGLRAVKKPDSALEETLEYAARLAAAEFC
00527261   1/1  plsfeelleilkklleelg..isdealekiyeltgGlprylellleellllalleeileilledvkkllk
00527251   1/1  ----------------------------------------------------------------------
00474201   1/1  ..eldpallsRf.lvielpppdleerleilkllleklglelsdealealaelspgnprellnl-------
00437921   1/1  lsrfdiiefkplseeelleilkrileeegvklsdealealaelsggdpraalnlleraaag---------
00476651   1/1  lvielpppsleerleilkllleklglplsdealealaelsggnprellnlleralllaleellt------
00494911   1/1  pallsRf.lvielpppsleerleilkllleklglelsdealealaelspg--------------------
00503741   1/1  dllerl...adrllsrfngkgivielpplsee--------------------------------------
00394721   1/1  ldpallrrfd------------------------------------------------------------
00402371   1/1  rp....elvklgeldpallrRfd.vielplpdleerle--------------------------------
00490531   1/1  tnrp.........ellkfeldpallrRf.lvielppp---------------------------------
00437901   1/1  ....dpeeldpallrRfd.iiefpppdeeelleilkrilekeglklddealealaelsegsprdllnlle
00404191   1/1  llsrldrvivldlppdleergeilkrlaeklglplsdevlellaert-----------------------
00367291   1/1  .......peeldpallrpgRfdlvielplpdlee------------------------------------
00420941   1/1  .........rpeeldpallrpgRfdlviefplpd------------------------------------
00386741   1/1  .......ldpallsRfdlvielpppdeeerleilkrllkkeglelddealealaelaegsprdllnll--
00437941   1/1  d.viefpppdeeelleilklilkkeglklddealellaelsggsprd-----------------------
00406781   1/1  ........leeldpallrpgrfdrvielplpdle------------------------------------
00521551   1/1  ........rpeeldpallrpgRfdlvielplpdl------------------------------------
00437981   1/1  ak...gvtvilathdlsell.........palls------------------------------------
00473941   1/1  .........ldpallsRfdlvielpppdleerleilkrllkkegvelddealellaelaggsardllnll
00418301   1/1  ..vdlpnvlviaatnpdly.....rpdeld----------------------------------------
00379261   1/1  gltdllgrtvdfkntiiiltsnvgelsggqrqrvalarallaepgilflDEiDklagkrggggtnrld--


                         -         *         -         -         -         -         +:350
query           NFVQYMGSQRYIHVAKVCKNGARWSEVKRYLQAVEGKPITDYEVTKLLKNLVDYGFLEKRGEIYLVPDPV
00527261   1/1  eelre-----------------------------------------------------------------
00527251   1/1  ---lllaskryllilkaiaglsrWseikryveaklGreisdstlsnllenLeklgfiekegelYlildPv
00474201   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LRTALQSLRC------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00527251   1/1  lrlalk----------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00490531   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00386741   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00379261   1/1  ----------------------------------------------------------------------